Возраст домена | 18 лет |
Дата окончания | Истек срок регистрации |
PR | 1 |
ИКС | |
Страниц в Google | 14 |
Страниц в Яндексе | 12 |
Dmoz | Нет |
Яндекс Каталог | Нет |
Alexa Traffic Rank | 11867684 |
Alexa Country | Нет данных |
История изменения показателей | Авторизация |
Идет сбор информации... Обновить
Dennis Cogan Philadelphia Criminal Defense Lawyer
Criminal Defense Lawyer, Criminal Defense Lawyer, Philadelphia Best Criminal Defense Lawyer, Philadelphia Homicide Lawyer, Philadelphia Drug Lawyer, Top rated Philadelphia Criminal Defense attorney, Philadelphia Super Lawyer, Criminal Defense Super Lawyer, Philadelphia Magazines Top Criminal Defense Lawyer
Dennis Cogan Selected 2011 Philadelphia General Criminal Defense Super Lawyer of the year.
UTF-8
16.87 КБ
494
3 772 симв.
3 171 симв.
Данные предоставлены сервисом semrush
Сайт | Общие фразы | PR | тИЦ | Alexa Rank | Alexa Country | |
---|---|---|---|---|---|---|
superlawyers.com | 14 | 6 |
0 | 86364 | 19837 | |
yellowpages.com | 10 | 7 |
0 | 4520 | 864 | |
philadelphiacriminallaw.com | 10 | 3 |
0 | 16199647 | Нет данных | |
philadelphiacriminaldefenselawyers.com | 10 | 3 |
0 | 5603502 | Нет данных | |
myphillycriminalattorney.com | 10 | 2 |
0 | 15342724 | Нет данных | |
mpmpc.com | 10 | 2 |
0 | 8591377 | Нет данных | |
henryfirm.com | 10 | 2 |
0 | Нет данных | Нет данных | |
findlaw.com | 10 | 7 |
0 | 5996 | 1245 | |
criminallawyerphiladelphia.com | 10 | 3 |
0 | 16045129 | Нет данных | |
avvo.com | 10 | 6 |
0 | 7004 | 1687 | |
Еще 31 сайт после авторизации |
Данные предоставлены сервисом semrush
Счетчик | Посетители за 24 часа | Просмотры | Просмотров на посетителя |
---|---|---|---|
Google Analytics | Нет доступа | Нет доступа | n/a |
Ссылок в Alexa | 7 |
Внешние ссылки главной страницы ( 7 ) | |
avvo.com/attorneys/19103-pa-dennis-cogan-427333.html?utm_cam... | Lawyer Dennis Cogan |
avvo.com/criminal-defense-lawyer/pa/philadelphia.html?utm_ca... | Top Attorney Criminal Defense |
superlawyers.com/redir?r=superlawyers.com/pennsylvania/lawye... | <img> |
superlawyers.com/redir?r=superlawyers.com&c=150_badge&i=home... | visit superlawyers.com |
martindale.com/Dennis-J-Cogan/1542524-lawyer.htm | <img> |
bestlawyers.com/Search/ShowProfile.aspx?rec_type=F&rec_id=33... | <img> |
bestlawyers.com/Search/ShowProfile.aspx?rec_type=L&rec_id=29... | <img> |
Внутренние ссылки главной страницы ( 8 ) | |
index.html | Home |
inthemedia.html | In the Media |
contact.html | Contact |
testimonials.html | Testimonials |
bio.html | Bio |
img/006021103DennisCogan.pdf | <img> |
news.html | Continue reading |
img/Cogan_Philadelphia_2013.pdf | Continue reading |
Domain Name: DENNISCOGAN.COM
Registry Domain ID: 234271202_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2017-07-20T14:06:20Z
Creation Date: 2005-10-18T15:55:33Z
Registry Expiry Date: 2019-10-18T15:55:33Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS1.DREAMHOST.COM
Name Server: NS2.DREAMHOST.COM
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2018-10-05T10:40:00Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar. Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.
TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.
The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.
User-agent: *
Allow: /
Sitemap: http://www.denniscogan.com/sitemap.xml
США - Сиэтл - 208.115.115.85
Wowrack.com
Wowrack.com
HTTP/1.1 200 OK
Date: Sat, 28 Dec 2019 15:39:10 GMT
Server: Apache
Upgrade: h2
Connection: Upgrade
Last-Modified: Tue, 12 Jul 2016 18:58:20 GMT
ETag: "4379-53774da396765"
Accept-Ranges: bytes
Content-Length: 17273
Vary: Accept-Encoding
Content-Type: text/html
Кнопка для анализа сайта в один клик, для установки перетащите ссылку на "Панель закладок"