Возраст домена | 10 лет |
Дата окончания | Истек срок регистрации |
ИКС | |
Страниц в Google | 195 |
Страниц в Яндексе | 46 |
Dmoz | Нет |
Яндекс Каталог | Нет |
Alexa Traffic Rank | 1864579 |
Alexa Country | 925974 |
История изменения показателей | Авторизация |
Идет сбор информации... Обновить
Fermented Foods and Probiotics | Probiotics, cultured foods, and prebiotics
n/a
n/a
UTF-8
60.29 КБ
1 669
12 375 симв.
10 405 симв.
Данные предоставлены сервисом semrush
Сайт | Общие фразы | PR | тИЦ | Alexa Rank | Alexa Country | |
---|---|---|---|---|---|---|
probiotics.org | 44 | 4 |
0 | 698859 | 351219 | |
probioticsguide.com | 38 | n/a | 0 | 1059331 | 324960 | |
vsl3.com | 25 | 4 |
0 | 593880 | 158102 | |
probiotic.org | 21 | 4 |
0 | 1186952 | 406889 | |
vsl3testimonials.com | 21 | 3 |
0 | 17925912 | Нет данных | |
florastor.com | 18 | 3 |
10 | 1351029 | 256933 | |
probioticcenter.com | 15 | n/a | 0 | 23760986 | Нет данных | |
100percenthealth.us | 10 | 1 |
0 | 3137604 | Нет данных | |
vsl3online.com | 10 | n/a | 0 | 20194049 | Нет данных | |
livesimplylivethriftylivesavvy.com | 5 | 2 |
0 | 6934675 | Нет данных | |
Еще 40 сайтов после авторизации |
Данные предоставлены сервисом semrush
Счетчик | Посетители за 24 часа | Просмотры | Просмотров на посетителя |
---|---|---|---|
Google Analytics | Нет доступа | Нет доступа | n/a |
Domain Name: FERMENTED-FOODS.COM
Registry Domain ID: 1835650677_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.enom.com
Registrar URL: www.enom.com
Updated Date: 2014-10-18T05:12:29.00Z
Creation Date: 2013-11-16T01:21:00.00Z
Registrar Registration Expiration Date: 2016-11-16T01:21:10.00Z
Registrar: ENOM, INC.
Registrar IANA ID: 48
Reseller: NAMECHEAP.COM
Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name: WHOISGUARD PROTECTED
Registrant Organization: WHOISGUARD, INC.
Registrant Street: P.O. BOX 0823-03411
Registrant City: PANAMA
Registrant State/Province: PANAMA
Registrant Postal Code: 00000
Registrant Country: PA
Registrant Phone: +507.8365503
Registrant Phone Ext:
Registrant Fax: +51.17057182
Registrant Fax Ext:
Registrant Email: D4805C140CEB4E67B350526A161C100D.PROTECT@WHOISGUARD.COM
Registry Admin ID:
Admin Name: WHOISGUARD PROTECTED
Admin Organization: WHOISGUARD, INC.
Admin Street: P.O. BOX 0823-03411
Admin City: PANAMA
Admin State/Province: PANAMA
Admin Postal Code: 00000
Admin Country: PA
Admin Phone: +507.8365503
Admin Phone Ext:
Admin Fax: +51.17057182
Admin Fax Ext:
Admin Email: D4805C140CEB4E67B350526A161C100D.PROTECT@WHOISGUARD.COM
Registry Tech ID:
Tech Name: WHOISGUARD PROTECTED
Tech Organization: WHOISGUARD, INC.
Tech Street: P.O. BOX 0823-03411
Tech City: PANAMA
Tech State/Province: PANAMA
Tech Postal Code: 00000
Tech Country: PA
Tech Phone: +507.8365503
Tech Phone Ext:
Tech Fax: +51.17057182
Tech Fax Ext:
Tech Email: D4805C140CEB4E67B350526A161C100D.PROTECT@WHOISGUARD.COM
Name Server: DNS1.NAMECHEAPHOSTING.COM
Name Server: DNS2.NAMECHEAPHOSTING.COM
Registrar Abuse Contact Email: abuse@enom.com
Registrar Abuse Contact Phone: +1.4252982646
Last update of WHOIS database: 2014-10-18T05:12:29.00Z
#
# robots.txt
#
# This file is to prevent the crawling and indexing of certain parts
# of your site by web crawlers and spiders run by sites like Yahoo!
# and Google. By telling these "robots" where not to go on your site,
# you save bandwidth and server resources.
#
# This file will be ignored unless it is at the root of your host:
# Used: http://example.com/robots.txt
# Ignored: http://example.com/site/robots.txt
#
# For more information about the robots.txt standard, see:
# http://www.robotstxt.org/wc/robots.html
#
# For syntax checking, see:
# http://www.sxw.org.uk/computing/robots/check.html
User-agent: *
Crawl-delay: 10
# Directories
Disallow: /includes/
##Disallow: /misc/
Disallow: /modules/
Disallow: /profiles/
Disallow: /scripts/
Disallow: /themes/
# Files
Disallow: /CHANGELOG.txt
Disallow: /cron.php
Disallow: /INSTALL.mysql.txt
Disallow: /INSTALL.pgsql.txt
Disallow: /INSTALL.sqlite.txt
Disallow: /install.php
Disallow: /INSTALL.txt
Disallow: /LICENSE.txt
Disallow: /MAINTAINERS.txt
Disallow: /update.php
Disallow: /UPGRADE.txt
Disallow: /xmlrpc.php
# Paths (clean URLs)
Disallow: /admin/
Disallow: /comment/reply/
Disallow: /filter/tips/
Disallow: /node/add/
Disallow: /search/
Disallow: /user/register/
Disallow: /user/password/
Disallow: /user/login/
Disallow: /user/logout/
# Paths (no clean URLs)
Disallow: /?q=admin/
Disallow: /?q=comment/reply/
Disallow: /?q=filter/tips/
Disallow: /?q=node/add/
Disallow: /?q=search/
Disallow: /?q=user/password/
Disallow: /?q=user/register/
Disallow: /?q=user/login/
Disallow: /?q=user/logout/
США - 50.63.45.1
GoDaddy.com, LLC
GoDaddy.com, LLC
HTTP/1.1 200 OK
Server: nginx/1.14.0
Date: Tue, 21 Jan 2020 11:33:10 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Drupal-Cache: HIT
Etag: "1579543167-0"
Content-Language: en
X-Frame-Options: SAMEORIGIN
X-Generator: Drupal 7 (http://drupal.org)
Link: ; rel="canonical",; rel="shortlink",; rel="shortcut icon",; rel="icon_16x16",; rel="icon_32x32",; rel="icon_96x96",; rel="icon_192x192",; rel="apple-touch-icon",; rel="apple-touch-icon_76x76",; rel="apple-touch-icon_114x114",; rel="apple-touch-icon_120x120",; rel="apple-touch-icon_144x144",; rel="apple-touch-icon_152x152",; rel="apple-touch-icon_180x180",; rel="apple-touch-icon-precomposed",; rel="apple-touch-icon-precomposed_72x72",; rel="apple-touch-icon-precomposed_76x76",; rel="apple-touch-icon-precomposed_114x114",; rel="apple-touch-icon-precomposed_120x120",; rel="apple-touch-icon-precomposed_144x144",; rel="apple-touch-icon-precomposed_152x152",; rel="apple-touch-icon-precomposed_180x180"
Cache-Control: public, max-age=86400
Expires: Sun, 19 Nov 1978 05:00:00 GMT
Vary: Cookie,Accept-Encoding
X-Content-Type-Options: nosniff
Last-Modified: Mon, 20 Jan 2020 17:59:27 GMT
Кнопка для анализа сайта в один клик, для установки перетащите ссылку на "Панель закладок"