Возраст домена | 19 лет |
Дата окончания | Истек срок регистрации |
PR | 3 |
ИКС | 10 |
Страниц в Google | 211000 |
Страниц в Яндексе | 3 |
Dmoz | Да |
Яндекс Каталог | Нет |
Alexa Traffic Rank | 2597586 |
Alexa Country | Нет данных |
История изменения показателей | Авторизация |
Идет сбор информации... Обновить
Free Hosted Forums | Free-Forums.org
free forum, free forums, create free forum, free phpBB3, free forum hosting, free phpbb forum hosting, free board, free board hosting, free discussion message board
Free forum hosting. We host your forum for FREE with 100% uptime. Get your FREE FORUMS now!
UTF-8
7.6 КБ
445
3 099 симв.
2 576 симв.
Данные предоставлены сервисом semrush
Сайт | Общие фразы | PR | тИЦ | Alexa Rank | Alexa Country | |
---|---|---|---|---|---|---|
foroomy.com | 5 | 2 |
10 | 1152249 | 133643 | |
alisamichelle.com | 5 | 3 |
0 | 5796050 | Нет данных | |
foxxrain.blogspot.com | 5 | n/a | 0 | Нет данных | Нет данных | |
jewelrywhore.com | 4 | 2 |
0 | 3115986 | Нет данных | |
joypolo.com | 4 | 1 |
20 | Нет данных | Нет данных | |
jewelrygiftsvalentinesday.appspot.com | 4 | n/a | 0 | Нет данных | Нет данных | |
cheap-ralphlauren-polo.com | 3 | n/a | 0 | Нет данных | Нет данных | |
firepolo.net | 3 | n/a | 0 | Нет данных | Нет данных | |
alisamichellecouture.com | 3 | 3 |
0 | Нет данных | Нет данных | |
stuartweitzmanalexespadrille521lop.blogspot.com | 2 | n/a | 0 | Нет данных | Нет данных | |
youtube.com | 2 | 9 |
0 | 2 | 2 | |
urbandictionary.com | 2 | 6 |
0 | 559 | 255 | |
myspace.com | 1 | 8 |
0 | 4674 | 2028 | |
muzofon.com | 1 | 4 |
0 | 192437 | 6804 | |
forbes.com | 1 | 8 |
0 | 289 | 109 | |
facebook.com | 1 | 9 |
0 | 3 | 3 | |
dailymail.co.uk | 1 | 7 |
0 | 214 | 128 | |
celtic-lyrics.com | 1 | 3 |
0 | 1320709 | Нет данных | |
answers.com | 1 | 7 |
0 | 1751 | 587 | |
amazon.com | 1 | 8 |
0 | 10 | 4 | |
Еще 30 сайтов после авторизации |
Данные предоставлены сервисом semrush
Данные linkpad ( 18 Ноября 2016 ) | |
Количество ссылок на сайт | 186 |
Количество доменов, которые ссылаются на сайт | 42 |
Количество найденных анкоров | 16 |
Исходящие (внешние) ссылки домена | 50 |
Количество доменов, на которые ссылается сайт | 17 |
Количество исходящих анкоров | 16 |
Внешние ссылки главной страницы ( 2 ) | |
freedropdomains.com/ | Expiring Domains |
echophp.com | echoPHP phpBB MultiForums |
Внутренние ссылки главной страницы ( 11 ) | |
free-forums.org/ | best free forum host |
/get-free-forum.html | Free Hosted Forum |
/board_directory.html nofollow | Directory |
support.free-forums.org/ nofollow | 24hr Support |
shadowsoul.free-forums.org/ nofollow | Supernatural Roleplay |
vinculumforums.free-forums.org/ nofollow | A Nice place to talk about anything you want with a nice welcoming community! |
kookpaleis.free-forums.org/ nofollow | recepten |
blackpill.free-forums.org/ nofollow | for those that know its over |
moviespy.free-forums.org/ nofollow | 1 |
horizonservers.free-forums.org/ nofollow | Horizon Servers forum |
sgbmc.free-forums.org/ nofollow | Motorcycle Privet Community |
Domain Name: FREE-FORUMS.ORG
Registry Domain ID: D106092769-LROR
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.whois.godaddy.com
Updated Date: 2018-04-17T11:52:20Z
Creation Date: 2005-04-16T11:25:29Z
Registry Expiry Date: 2019-04-16T11:25:29Z
Registrar Registration Expiration Date:
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: +1.4806242505
Reseller:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registrant Organization: Domains By Proxy, LLC
Registrant State/Province: Arizona
Registrant Country: US
Name Server: NS75.DOMAINCONTROL.COM
Name Server: NS76.DOMAINCONTROL.COM
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2018-12-22T00:47:14Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
Access to Public Interest Registry WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the Public Interest Registry registry database. The data in this record is provided by Public Interest Registry for informational purposes only, and Public Interest Registry does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to (a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Afilias except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. Public Interest Registry reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy.
The Registrar of Record identified in this output may have an RDDS service that can be queried for additional information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
User-agent: *
Disallow:
User-agent: MJ12bot
User-agent: rogerBot
User-agent: AhrefsBot
User-agent: ia_archiver
Disallow: /
США - 72.21.194.1
США - 72.21.211.176
США - 72.21.214.128
Amazon.com
Amazon.com
HTTP/1.1 200 OK
Date: Tue, 08 Oct 2019 00:24:11 GMT
Server: Apache
Expires: Mon, 26 Jul 1997 05:00:00 GMT
Last-Modified: Tue, 08 Oct 2019 00:24:11 GMT
Cache-Control: no-store, no-cache, must-revalidate
Cache-Control: post-check=0, pre-check=0
Pragma: no-cache
Vary: Accept-Encoding
Content-Length: 7787
Connection: close
Content-Type: text/html; charset=UTF-8
Кнопка для анализа сайта в один клик, для установки перетащите ссылку на "Панель закладок"