Возраст домена | 22 года |
Дата окончания | Истек срок регистрации |
PR | 4 |
ИКС | 60 |
Страниц в Google | 65300 |
Страниц в Яндексе | 4000 |
Dmoz | Да |
Яндекс Каталог | Нет |
Alexa Traffic Rank | 297657 |
Alexa Country | 13724 |
История изменения показателей | Авторизация |
Идет сбор информации... Обновить
TackleTour.com ~ The Angler's Source for Tackle Reviews and Tackle News!
tackletour fishing reviews news bass largemouth bass smallmouth bass striped bass swimbaits trout lures angler freshwater saltwater lakes rivers streams rods spinning reels Shimano Daiwa casting fly ranger boats yamamoto plastics worms crankbait spinnerbaits jerkbaits gamakatsu hooks
The anglers source for tackle news and reviews. 100% independent review site.
UTF-8
53.49 КБ
2 319
16 416 симв.
13 519 симв.
Данные предоставлены сервисом semrush
Сайт | Общие фразы | PR | тИЦ | Alexa Rank | Alexa Country | |
---|---|---|---|---|---|---|
tacklewarehouse.com | 1448 | 4 |
0 | 53281 | 12910 | |
tackledirect.com | 1252 | 5 |
0 | 84528 | 21085 | |
fishusa.com | 985 | 4 |
20 | 147605 | 31873 | |
bassresource.com | 733 | 4 |
10 | 129696 | 32769 | |
wired2fish.com | 491 | 3 |
0 | 125249 | 29858 | |
outdoorproshop.com | 359 | 3 |
0 | 731462 | 149302 | |
westernbass.com | 334 | 4 |
0 | 256036 | 68319 | |
meltontackle.com | 274 | 4 |
0 | 591299 | 123633 | |
basstackledepot.com | 228 | 3 |
0 | 15520807 | Нет данных | |
360tuna.com | 212 | 2 |
0 | 981133 | 218676 | |
youtube.com | 82 | 9 |
0 | 2 | 2 | |
ebay.com | 68 | 8 |
0 | 42 | 11 | |
amazon.com | 55 | 8 |
0 | 10 | 4 | |
shimano.com | 31 | 6 |
230 | 25268 | 11102 | |
basspro.com | 29 | 6 |
0 | 11805 | 3513 | |
shimano.ru | 16 | 2 |
70 | 1242814 | 99623 | |
rybalka.ru | 16 | 2 |
60 | 275821 | 25925 | |
ldmarket.ru | 14 | 2 |
90 | 403972 | 32131 | |
Еще 32 сайта после авторизации |
Данные предоставлены сервисом semrush
Счетчик | Посетители за 24 часа | Просмотры | Просмотров на посетителя |
---|---|---|---|
Google Analytics | Нет доступа | Нет доступа | n/a |
Данные linkpad ( 10 Ноября 2016 ) | |
Количество ссылок на сайт | 34358 |
Количество доменов, которые ссылаются на сайт | 457 |
Количество найденных анкоров | 439 |
Исходящие (внешние) ссылки домена | 23062 |
Количество доменов, на которые ссылается сайт | 106 |
Количество исходящих анкоров | 111 |
Внешние ссылки главной страницы ( 21 ) | |
tacklewarehouse.com/25days.html?from=tactour&utm_source=tack... | <img> |
tackletour.net/ | TACKLETOUR FORUMS |
facebook.com/TackleTour | <img> |
twitter.com/teamtackletour | <img> |
instagram.com/tackletour/ | <img> |
youtube.com/user/zandertt | <img> |
tacklewarehouse.com/giftcards.html?from=tactour&utm_source=t... | <img> |
bassanglermag.com/subscribe/ | <img> |
bit.ly/2AM73Wb | <img> |
outdoorproshop.com/Strike-King-10XD-Crankbait-p/strike-king-... | <img> |
bit.ly/2FtpSAR | <img> |
tacklewarehouse.com/Shimano/catpage-SHIMANO.html?from=tactou... | <img> |
aftco.com/products/jason-christie-fishing-bass-long-sleeve-p... | <img> |
sunlineamerica.com/ | <img> |
amzn.to/365RyXp | <img> |
japantackle.com/ | <img> |
tacklewarehouse.com/Cal_Coast_Fishing_Clip-N-Cull_20_Culling... | <img> |
outdoorproshop.com/Jackall-Gantarel-p/jackall-gan.htm?Click=... | <img> |
tackletrap.com/ | <img> |
demystifly.com/ | <img> |
google.com/ | <img> |
Внутренние ссылки главной страницы ( 76 ) | |
tackletour.com | <img> |
forums.tackletour.com/ | - |
editorschoice.html | EDITOR'S CHOICE |
menuarchive.html | REVIEW ARCHIVE |
about.html | ABOUT US |
menureels.html | Reels |
menurods.html | Rods |
menulines.html | Lines |
menulures.html | Lures |
menubasictackle.html | Terminal Tackle |
menutools.html | Tools |
menustorage.html | Storage |
menuwatercraft.html | Watercraft |
menuclothing.html | Apparel |
menuenthusiasttackle.html | Enthusiast |
menuinterviews.html | Interviews |
menuevents.html | Events |
menumaintenance.html | Maintenance |
menuautopsy.html | Autopsy |
specialicast2019coverage.html | ICAST 2019 Update Coverage |
reviewshimanoantaresa70.html | One for the Enthusiasts: The Shimnao Antares A70 Baitcaster with MGIII |
reviewmegabassdarksleeper.html | Small but Mighty, the Megabass Dark Sleeper Swimbait |
reviewshimanobantam150xg.html | SOLID! The Shimano Bantam MGL Baitcaster |
tackletour.com/reviewwalkingsetups.html | Selecting the right Rod, Reel, and Line for Your Walking Bait Arsenal |
reviewberkleypowerbaitjestercraw.html | <img> |
reviewbullshadwakingbait.html | SLURPOWW!! Bull Shad Swimbait's Bull Wake |
reviewquantumaccurists3spin.html | Quantum's Colorful Accurist S3 Spinning Reel |
reviewbaitsanityantidote.html | The Cure for Big Bait - Big Price Fatigue: The Baitsanity Antidote Glide |
reviewdoomsdayT47S370MF.html | A Shot of Finesse with a Dash of Versatility : Doomsday Tackle's T47S-370MF |
reviewmbdestroyermark48.html | Taking Aim with Megabass's Destroyer F8-78X Mark 48 |
reviewstrikekingkvddeepjerkbait.html | Strike King Adds Depth to KVD's Jerkbait Arsenal |
reviewdirtyjigsswimjig.html | Getting Down and Dirty with the Swim Jig |
reviewmegabassgaruda.html | Here to Challenge Your Imagination : Megabass of America's Garuda |
reviewjulbopaddlesunglasses.html | Float from the Beach to the Bar - Julbo Paddle Optics |
reviewabuikerevo4spin.html | Mike Iaconelli's Signature Spinning Reel from Abu Garcia |
reviewlewstlpt170m.html | The Search for One : Lew's Pro-Ti TLPT170M |
reviewjackallrhythmwave.html | Underrated Over Performer, the Jackall Rhythm Wave |
reviewmegabassijack.html | Knock Knock Knocking on Bassie's Door - The Megabass I-Jack |
previewshimanobantamgloomisimxcombo.html | Shimano and G.Loomis Launch Limited Edition Bantam MGL & IMX-Pro Combos |
reviewaftcobarracudageocool.html | Chill Out with the Barracuda Geo Cool Hooded Sunshirt by AFTCO |
reviewstrikekingrageswimmer.html | Is Strike King's New Swimmer All The Rage? |
reviewabumikec7106delay.html | Wait for It, Wait for It... Abu Garcia's IKE Delay Series |
review13fishinginceptionsz.html | Leaner, Meaner, and a whole lot Greener. Meet the 13 Fishing Inception Sport Z Baitcaster |
reviewaftcotacticalshorts.html | They Had Me At the Button : AFTCO's Tactical Fishing Shorts |
reviewcatchzerogravityunderspin.html | Not Really Defying Gravity, But Better For the Environment : Catch Outdoors's Z.G.H.A. Underspin |
previewbubba.html | - |
reviewabugarciarevo4beast.html | Abu Garcia's Revo4 Beast is a Beauty |
previewstanleyhale2019.html | Stanley Jigs Refreshes Their Lineup |
reviewwitchdoctorshamanrod.html | A Mix of Handling and Power Voodoo in the Witch Doctor Shaman Rods |
reviewtrophybasssgtglide.html | Trophy Bass Baits's Intriguing SGT Glide |
review2019valuereelroundup.html | Do You Believe in Magic? Our $99 Low Profile Casting Reel Round Up |
reviewstrikekingkvdsquarebill.html | Strike King's Four Wheel Drive : the KVD Squarebill Crank |
reviewdenalil883ms.html | A Spinning Rod with Multiple Personalities : Denali's Lithium L883MS Multi-Spin |
reviewbuffeclipsesungloves.html | Blocking out the Burn ? Buff?s Eclipse Gloves |
reviewlewshypermagslpcasting.html | Lew's Goes Mg with their Hyper Mag SLP |
reviewwildluresbeat.html | Give Me a Beat! ... and Make it Wild |
reviewsunlinefccrank.html | Cranking It Up with Sunline's Crank FC |
reviewfinaticproseriesfc.html | Putting Finatic's Pro Series FC to the Test |
reviewygktourgradefc.html | YGK's Tour Grade FC Has Soul |
reviewhiseasflurocarbon.html | A Quality FC Line from Hi-Seas : 100% Fluorocarbon |
reviewsunlinesniper.html | Sunline's Best Selling Fluorocarbon In Our Sights : Sniper |
review6thsenseflowglider.html | Going With The Flow... Glider by 6th Sense Fishing |
reviewarkts73mhfc.html | ARK Rods's TS73MHFC May Not Be a Printer, But It Is Money |
previewbuffalexandranicole.html | BUFF's Cooling Technology Coming to Spring 2020 Angler Collection |
reviewevergreenjackhammer.html | Why Don't You Call My Name? Evergreen and Zmans' Jack Hammer |
reviewirodair7104prgh.html | Bub's Punch Rod Levels Up : iRod AIR IRA7104PRG-H |
reviewaburevo4rocket.html | Abu Garcia Begins the Countdown to Liftoff with the 10.1:1 Revo4 Rocket |
reviewmb17destroyerwarhammer.html | Are You Worthy to Possess the Power of Megabass's Warhammer? |
reviewbullshadknocker.html | Opportunity is 2Knocking for Bull Shad Swimbaits |
previewdaiwablxbassrods.html | Daiwa Introduces a Refreshed Black Label Series - the BLX Bass Rods |
reviewicast19abugarciabaitcastersbeast.html | Abu Garcia Feeds the Need for Speed, and Refinement, with Two New Sleek Baitcasters |
reviewicast19bigbitebaits.html | A New Trailer and Terminal Tackle from Big Bite Baits |
reviewicast19spro.html | Spro Joins the Spybaiting Agency with the Spin Jon 80 |
reviewicast19sufix.html | Spro Joins the Spybaiting Agency with the Spin Jon 80 |
reviewicast19abugarciabaitcasters.html | Abu Garcia Feeds the Need for Speed, and Refinement, with Two New Sleek Baitcasters |
privacypolicy.html | Privacy Policy information |
Domain Name: TACKLETOUR.COM
Registry Domain ID: 80233397_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2016-10-22T18:30:31Z
Creation Date: 2001-11-26T04:15:22Z
Registrar Registration Expiration Date: 2021-11-26T04:15:22Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Registrant Organization:
Registrant State/Province: California
Registrant Country: US
Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=TACKLETOUR.COM
Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=TACKLETOUR.COM
Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=TACKLETOUR.COM
Name Server: YNS1.YAHOO.COM
Name Server: YNS2.YAHOO.COM
>>> Last update of WHOIS database: 2019-01-20T17:00:00Z <<<
For more information on Whois status codes, please visit https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en
Notes:
IMPORTANT: Port43 will provide the ICANN-required minimum data set per
ICANN Temporary Specification, adopted 17 May 2018.
Visit https://whois.godaddy.com to look up contact data for domains
not covered by GDPR policy.
Sitemap:http://tackletour.com/sitemap.xml
Россия - 212.193.245.64
Autonomous Non-commercial Organization 'Regional N
ROSNIIROS Russian Institute for Public Networks
HTTP/1.1 200 OK
Date: Wed, 01 Jan 2020 08:17:19 GMT
Set-Cookie: BX=d2eeha9f0olcf&b=3&s=ml; expires=Sat, 01-Jan-2022 08:17:19 GMT; path=/; domain=.tackletour.com
P3P: policyref="http://info.yahoo.com/w3c/p3p.xml", CP="CAO DSP COR CUR ADM DEV TAI PSA PSD IVAi IVDi CONi TELo OTPi OUR DELi SAMi OTRi UNRi PUBi IND PHY ONL UNI PUR FIN COM NAV INT DEM CNT STA POL HEA PRE LOC GOV"
X-Host: p11w78.geo.bf1.yahoo.com
X-INKT-URI: http://www.tackletour.com//index.html
X-INKT-SITE: http://www.tackletour.com
Expires: Tue, 31 Dec 2019 08:17:19 GMT
Pragma: no-cache
Last-Modified: Wed, 01 Jan 2020 08:17:19 GMT
Content-Type: text/html
Age: 0
Transfer-Encoding: chunked
Connection: keep-alive
Server: ATS/7.1.2
Кнопка для анализа сайта в один клик, для установки перетащите ссылку на "Панель закладок"