Возраст домена | 11 лет |
Дата окончания | Истек срок регистрации |
ИКС | |
Страниц в Google | 2 |
Страниц в Яндексе | 1 |
Dmoz | Нет |
Яндекс Каталог | Нет |
Alexa Traffic Rank | 8922611 |
Alexa Country | Нет данных |
История изменения показателей | Авторизация |
Идет сбор информации... Обновить
n/a
n/a
n/a
ASCII
2.19 КБ
30
187 симв.
151 симв.
Ссылок в Alexa | 72 |
Внешние ссылки главной страницы ( 5 ) | |
dynadot.com/community/help/question/renew-domain?drefid=121 nofollow | renew |
dynadot.com/domain/search.html?drefid=121 nofollow | domain |
dynadot.com/website-builder/?drefid=121 nofollow | build your website |
dynadot.com/?drefid=121 nofollow | Dynadot.com |
dynadot.com/market/auction/ nofollow | Expired Domain Auctions |
[Querying whois.verisign-grs.com]
[Redirected to whois.enom.com]
[Querying whois.enom.com]
[whois.enom.com]
=-=-=-=
Registration Service Provided By: Namecheap.com
Contact: support@namecheap.com
Visit: http://namecheap.com
Domain name: 500lovemakingtipsandsecretsreview.com
Registrant Contact:
WhoisGuard
WhoisGuard Protected ()
Fax:
11400 W. Olympic Blvd. Suite 200
Los Angeles, CA 90064
US
Administrative Contact:
WhoisGuard
WhoisGuard Protected (cac90c0b15a14e72ae881f3f70c683c9.protect@whoisguard.com)
+1.6613102107
Fax: +1.6613102107
11400 W. Olympic Blvd. Suite 200
Los Angeles, CA 90064
US
Technical Contact:
WhoisGuard
WhoisGuard Protected (cac90c0b15a14e72ae881f3f70c683c9.protect@whoisguard.com)
+1.6613102107
Fax: +1.6613102107
11400 W. Olympic Blvd. Suite 200
Los Angeles, CA 90064
US
Status: Locked
Name Servers:
ns1955.hostgator.com
ns1956.hostgator.com
Creation date: 08 Feb 2013 07:08:00
Expiration date: 07 Feb 2014 23:08:00
=-=-=-=
The data in this whois database is provided to you for information
purposes only, that is, to assist you in obtaining information about or
related to a domain name registration record. We make this information
available "as is," and do not guarantee its accuracy. By submitting a
whois query, you agree that you will use this data only for lawful
purposes and that, under no circumstances will you use this data to: (1)
enable high volume, automated, electronic processes that stress or load
this whois database system providing you this information; or (2) allow,
enable, or otherwise support the transmission of mass unsolicited,
commercial advertising or solicitations via direct mail, electronic
mail, or by telephone. The compilation, repackaging, dissemination or
other use of this data is expressly prohibited without prior written
consent from us.
We reserve the right to modify these terms at any time. By submitting
this query, you agree to abide by these terms.
Version 6.3 4/3/2002
США - 174.120.105.253
SoftLayer Technologies
ThePlanet.com Internet Services
HTTP/1.1 200 OK
Date: Thu, 26 Sep 2019 13:09:12 GMT
Connection:Keep-Alive
Content-Length: 2244
Cache-Control: private, no-cache, no-store, max-age=0
Expires: Mon, 01 Jan 1990 0:00:00 GMT
X-Frame-Options: DENY
Кнопка для анализа сайта в один клик, для установки перетащите ссылку на "Панель закладок"