Возраст домена | 9 лет |
Дата окончания | Истек срок регистрации |
ИКС | n/a |
Страниц в Google | 28 |
Страниц в Яндексе | 1 |
Dmoz | Нет |
Яндекс Каталог | Нет |
Alexa Traffic Rank | Нет данных |
Alexa Country | Нет данных |
История изменения показателей | Авторизация |
Идет сбор информации... Обновить
Adams Chimney Specialist LLC | Oregon CCB# 212351 Washington CC# ADAMSCS852CZ Licensed, Bonded, Insured
n/a
Oregon CCB# 212351 Washington CC# ADAMSCS852CZ Licensed, Bonded, Insured
UTF-8
74.32 КБ
505
3 954 симв.
3 351 симв.
Данные предоставлены сервисом semrush
Сайт | Общие фразы | PR | тИЦ | Alexa Rank | Alexa Country | |
---|---|---|---|---|---|---|
yelp.com | 19 | 7 |
0 | 201 | 39 | |
vancouverchimney.net | 10 | n/a | 0 | 19270919 | Нет данных | |
thetophattercleaning.com | 10 | 2 |
0 | 11311157 | Нет данных | |
angieslist.com | 10 | 6 |
0 | 8706 | 1495 | |
vancouverfireplaceandchimneyrepair.com | 9 | n/a | 0 | Нет данных | Нет данных | |
thumbtack.com | 9 | 5 |
0 | 8094 | 1418 | |
matchboxchimney.com | 9 | 1 |
0 | 17638865 | Нет данных | |
brodleschimney.com | 9 | n/a | 0 | 22040702 | Нет данных | |
homeadvisor.com | 8 | 7 |
0 | 6267 | 1088 | |
ayourtownchimney.com | 8 | 1 |
0 | 10774335 | Нет данных | |
Еще 40 сайтов после авторизации |
Данные предоставлены сервисом semrush
Счетчик | Посетители за 24 часа | Просмотры | Просмотров на посетителя |
---|---|---|---|
Google Analytics | Нет доступа | Нет доступа | n/a |
Domain Name: ACHIMNEYSPECIALIST.COM
Registry Domain ID: 1901833748_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.wildwestdomains.com
Registrar URL: http://www.wildwestdomains.com
Updated Date: 2017-01-11T13:22:15Z
Creation Date: 2015-02-10T05:27:34Z
Registry Expiry Date: 2018-02-10T05:27:34Z
Registrar: Wild West Domains, LLC
Registrar IANA ID: 440
Registrar Abuse Contact Email: abuse@wildwestdomains.com
Registrar Abuse Contact Phone: +1.4806242505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS1.WORDPRESS.COM
Name Server: NS2.WORDPRESS.COM
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-07-28T02:41:22Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar. Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.
TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.
The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.
# If you are regularly crawling WordPress.com sites, please use our firehose to receive real-time push updates instead.
# Please see https://developer.wordpress.com/docs/firehose/ for more details.
Sitemap: https://achimneyspecialist.com/sitemap.xml
Sitemap: https://achimneyspecialist.com/news-sitemap.xml
User-agent: *
Disallow: /wp-admin/
Allow: /wp-admin/admin-ajax.php
Disallow: /wp-login.php
Disallow: /wp-signup.php
Disallow: /press-this.php
Disallow: /remote-login.php
Disallow: /activate/
Disallow: /cgi-bin/
Disallow: /mshots/v1/
Disallow: /next/
Disallow: /public.api/
# This file was generated on Sun, 27 Oct 2019 03:22:47 +0000
США - 50.63.114.1
GoDaddy.com, LLC
GoDaddy.com, LLC
HTTP/1.1 200 OK
Server: nginx
Date: Tue, 14 Jan 2020 05:29:49 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Strict-Transport-Security: max-age=86400
Vary: Accept-Encoding
Vary: Cookie
X-hacker: If you're reading this, you should visit automattic.com/jobs and apply to join the fun, mention this header.
Link: ; rel=shortlink
X-ac: 3.dca _dca
Кнопка для анализа сайта в один клик, для установки перетащите ссылку на "Панель закладок"