Возраст домена | n/a |
Дата окончания | n/a |
ИКС | |
Страниц в Google | 176 |
Страниц в Яндексе | 1 |
Dmoz | Нет |
Яндекс Каталог | Нет |
Alexa Traffic Rank | Нет данных |
Alexa Country | Нет данных |
История изменения показателей | Авторизация |
Идет сбор информации... Обновить
FREE LOVE SPELLS THAT WORK - VOODOO LOVE SPELLS BLACK MAGIC SPELLS magic spells wiccan white spells
love spells, free spells, voodoo spells, black magic spells, white magic spells, magic spells, wicca spells, wiccan spells, free love spells, easy love spells, spells
SPELL 4 FREE: THE MAGICK PLACE TO BE! Powerful spells cast by me for free. Choose between many types: Free Love spells Free easy spells spell casters wiccan to voodoo love spells powerful guaranteed free white magick spells and black magic spells or wicca
WINDOWS-1252
19.87 КБ
1 277
8 651 симв.
7 084 симв.
Ссылок в Alexa | 24 |
Данные linkpad ( 14 Ноября 2013 ) | |
Количество ссылок на сайт | 17 |
Количество доменов, которые ссылаются на сайт | 8 |
Количество найденных анкоров | 9 |
Исходящие (внешние) ссылки домена | 0 |
Количество доменов, на которые ссылается сайт | 0 |
Количество исходящих анкоров | 0 |
Внешние ссылки главной страницы ( 7 ) | |
Www.spells4free.net | spells |
powerfulblackmagicspells.com | powerfulblackmagicspells.com |
witchcraftspells.online | www.witchcraftspells.online |
voodooandspells.com | www.voodooandspells.com |
animalreadings.info | Free READINGS |
facebook.com/PowerfulFullMoon | Full moon page |
facebook.com/LuckCalculator | Luck Calculator |
Внутренние ссылки главной страницы ( 48 ) | |
freespellscast.html | FREE SPELLS |
bestlovepsychicspellscastersreviews.html | real and honest spell casters |
/freelovespellsblog | READ MY BLOG |
freelovespellsmailinglist.html | Free powerful Love Spell |
<img> | |
../White-Magic-Love-Spells/ | White Magic Love Spells |
../Money-Spells/ | Money Spells |
../Protection-Spells/ | Protection Spells |
../Beauty-Spells/ | Beauty Spells |
../freespellscast.html | free spells |
../voodoospells.html | Voodoo Spells |
../Hoodoo-Spells/ | Hoodoo Spells |
../White-Magic-Spells/ | White Magic Spells |
../Black-Magic/ | Black Magic |
../Wicca-Spells/ | Wicca Spells |
/freelovespellsblog/ | READ MY BLOG |
wishingwell.php | READ MORE AND POST YOUR OWN WISH |
../Wishing-Well/ | Wishing Well |
../Alternative-Medicines/ | Alternative Medicines |
../Egyptian-Amulets/ | Egyptian Amulets |
../Angels/ | Angels |
../Article/ | Articles |
../Articles-Not-About-Spells-Or-Magick/ | Articles not about Spells or Magick |
../Astral-Projection | Astral Projection |
../Black-Magic-Love-Spells/ | Black Magic Love Spells |
../Feng-Shui/ | Feng Shui |
../Healing-Spells/ | Healing Spells |
../Hypnosis/ | Hypnosis |
../Law-of-Attraction/ | Law of Attraction |
../Prayers/ | Prayers |
../Voodoo-Love-Spells/ | Voodoo Love Spells |
../Candle-Spells/ | Candle Spells |
voodoospells.html | Voodoo Spells |
../White-Magic-Love-Spells/Spell-to-Bring-Someone-Closer.htm... | Spell to Bring Someone Closer |
../White-Magic-Love-Spells/Make-Him-Love-You.html | Make Him Love You |
luckcalculator.html | Check your LUCK |
onlinetarotcardsreadings.html | Tarot Card Readings |
freedailyhoroscopes | Free Daily Horoscope |
zodiac-love-compatibility.html | Love Compatibility |
datingtipsandlovespells.html | Dating Tips |
fullmoon.html | Full Moon |
magickstones.html | Magick Stones |
lovespellsthatwork.html | Love Spells That Work |
populararticles.html | Most Popular Spells |
linkus.html | Links and Link Exchange |
submitguidelines.html | Submission Guidelines |
privacy.html | Privacy Policy |
terms.html | Terms of Service |
[Querying whois.verisign-grs.com]
[Redirected to whois.godaddy.com]
[Querying whois.godaddy.com]
[whois.godaddy.com]
Domain Name: ALLIEDPSYCHICS.COM
Registrar URL: http://www.godaddy.com
Registrant Name: Registration Private
Registrant Organization: Domains By Proxy, LLC
Name Server: NS419.WEBSITEWELCOME.COM
Name Server: NS420.WEBSITEWELCOME.COM
DNSSEC: unsigned
For complete domain details go to:
http://who.godaddy.com/whoischeck.aspx?domain=ALLIEDPSYCHICS.COM
The data contained in GoDaddy.com, LLC's WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This
information is provided for the sole purpose of assisting you
in obtaining information about domain name registration records.
Any use of this data for any other purpose is expressly forbidden without the prior written
permission of GoDaddy.com, LLC. By submitting an inquiry,
you agree to these terms of usage and limitations of warranty. In particular,
you agree not to use this data to allow, enable, or otherwise make possible,
dissemination or collection of this data, in part or in its entirety, for any
purpose, such as the transmission of unsolicited advertising and
and solicitations of any kind, including spam. You further agree
not to use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial purposes.
Please note: the registrant of the domain name is specified
in the "registrant" section. In most cases, GoDaddy.com, LLC
is not the registrant of domain names listed in this database.
США - 192.185.56.118
CyrusOne LLC
Websitewelcome.com
HTTP/1.1 200 OK
ETag: "05c104f54-0;;;"
Last-Modified: Tue, 11 Dec 2018 23:59:16 GMT
Content-Type: text/html
Content-Length: 20347
Accept-Ranges: bytes
Date: Mon, 01 Jul 2019 09:16:24 GMT
Strict-Transport-Security: max-age=63072000; includeSubDomains
X-Frame-Options: SAMEORIGIN
X-Content-Type-Options: nosniff
Vary: User-Agent
Cache-Control: max-age=3600, must-revalidate
Alt-Svc: quic=":443"; ma=2592000; v="35,39,43,44"
Connection: Keep-Alive
Кнопка для анализа сайта в один клик, для установки перетащите ссылку на "Панель закладок"