Возраст домена | 19 лет |
Дата окончания | Истек срок регистрации |
PR | 3 |
ИКС | n/a |
Страниц в Google | 87 |
Страниц в Яндексе | 4 |
Dmoz | Нет |
Яндекс Каталог | Нет |
Alexa Traffic Rank | 9434284 |
Alexa Country | Нет данных |
История изменения показателей | Авторизация |
Идет сбор информации... Обновить
Aptech Training Solutions | Corporate training & development
aptech training solutions, leading corporate training company in india, project management certification training, professional training
Aptech Training Solutions offers customized corporate training programs in sales, project management, customer service, soft skills, IT & process knowledge.
UTF-8
46.94 КБ
110
926 симв.
804 симв.
Данные предоставлены сервисом semrush
Сайт | Общие фразы | PR | тИЦ | Alexa Rank | Alexa Country | |
---|---|---|---|---|---|---|
![]() ![]() |
2 | 9 |
0 | 5 | ![]() | |
![]() ![]() |
2 | 7 |
0 | 10843 | ![]() | |
![]() ![]() |
2 | 5 |
10 | 735258 | ![]() | |
![]() |
1 | 4 |
0 | 17056220 | ![]() |
|
![]() |
1 | 1 |
0 | 449721 | ![]() | |
![]() ![]() |
1 | 5 |
0 | 177881 | ![]() | |
![]() ![]() |
1 | 6 |
0 | 877793 | ![]() | |
![]() |
1 | 2 |
0 | 2400060 | ![]() |
|
![]() |
1 | 3 |
0 | 1650309 | ![]() | |
![]() |
1 | 3 |
0 | 2521372 | ![]() |
|
Еще 26 сайтов после авторизации |
Данные предоставлены сервисом semrush
Счетчик | Посетители за 24 часа | Просмотры | Просмотров на посетителя |
---|---|---|---|
![]() | Нет доступа | Нет доступа | n/a |
Ссылок в Alexa | 12 |
Данные linkpad ( 23 Июня 2014 ) | |
Количество ссылок на сайт | 9 |
Количество доменов, которые ссылаются на сайт | 5 |
Количество найденных анкоров | 4 |
Исходящие (внешние) ссылки домена | 40 |
Количество доменов, на которые ссылается сайт | 16 |
Количество исходящих анкоров | 7 |
Внутренние ссылки главной страницы ( 10 ) | |
home.aspx | <img> |
services-pmp-training.aspx | <img> |
solutions.aspx | more |
services.aspx | customized training services |
products.aspx | off-the-shelf products |
trainingprocess.aspx | <img> |
aboutaptech.shtml | About Aptech |
careers.shtml | Careers |
contactus.shtml | Contact us |
disclaimer.shtml | Disclaimer & Terms of Use |
Domain Name: APTECHLEARNINGSERVICES.COM
Registry Domain ID: 133753366_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.publicdomainregistry.com
Registrar URL: www.publicdomainregistry.com
Updated Date: 24-Jul-2013
Creation Date: 27-Oct-2004
Registrar Registration Expiration Date: 27-Oct-2015
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registrar IANA ID: 303
Registrar Abuse Contact Email: abuse-contact@publicdomainregistry.com
Registrar Abuse Contact Phone: +1-2013775952
Domain Status: clientTransferProhibited
Registry Registrant ID: PP-SP-001
Registrant Name: Domain Admin
Registrant Organization: Privacy Protection Service INC d/b/a PrivacyProtect.org
Registrant Street: C/O ID#10760, PO Box 16 Note - Visit PrivacyProtect.org to contact the domain owner/operator Note - Visit PrivacyProtect.org to contact the domain owner/operator
Registrant City: Nobby Beach
Registrant State/Province: Queensland
Registrant Postal Code: QLD 4218
Registrant Country: AU
Registrant Phone: +45.36946676
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: contact@privacyprotect.org
Registry Admin ID: PP-SP-001
Admin Name: Domain Admin
Admin Organization: Privacy Protection Service INC d/b/a PrivacyProtect.org
Admin Street: C/O ID#10760, PO Box 16 Note - Visit PrivacyProtect.org to contact the domain owner/operator Note - Visit PrivacyProtect.org to contact the domain owner/operator
Admin City: Nobby Beach
Admin State/Province: Queensland
Admin Postal Code: QLD 4218
Admin Country: AU
Admin Phone: +45.36946676
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: contact@privacyprotect.org
Registry Tech ID: PP-SP-001
Tech Name: Domain Admin
Tech Organization: Privacy Protection Service INC d/b/a PrivacyProtect.org
Tech Street: C/O ID#10760, PO Box 16 Note - Visit PrivacyProtect.org to contact the domain owner/operator Note - Visit PrivacyProtect.org to contact the domain owner/operator
Tech City: Nobby Beach
Tech State/Province: Queensland
Tech Postal Code: QLD 4218
Tech Country: AU
Tech Phone: +45.36946676
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: contact@privacyprotect.org
Name Server: dns1.aptech.ac.in
Name Server: gurukul.aptech.ac.in
http://wdprs.internic.net/
>>>Last update of WHOIS database: 2014-08-30T12:21:39+0000Z<<<
User-agent: *
Disallow: /Awards/
Disallow: /Bin/
Disallow: /BLL/
Disallow: /DAL/
Disallow: /css/
Disallow: /includes/
Disallow: /flash/
Disallow: /images/
Disallow: /js/
Disallow: /pages/images/
Disallow: /Scripts/
Disallow: /*.pdf$
Disallow: /*.html$
Disallow: /*.htm$
Disallow: /*.shtml$
Disallow: /*.asp$
Disallow: /*.aspx$
Disallow: /*.gif$
Disallow: /*.png$
Disallow: /*.jpg$
Disallow: /*.js$
Disallow: /index.html
Disallow: /pages/aboutus_aboutaptechlearningservices.html
Disallow: /pages/aboutus_advantageaptech.html
Disallow: /pages/aboutus_whyaptechlearningservices.html
Disallow: /pages/solutions.html
Disallow: /pages/solutions_contentdevelopment.html
Disallow: /pages/solutions_multimediaproduction.html
Disallow: /pages/solutions_othersolutions.html
Disallow: /pages/services.html
Disallow: /pages/services_consulting.html
Disallow: /pages/services_consulting_cvurriculumdesign.html
Disallow: /customisedcontent.shtml
Disallow: /pages/services_managedservices.html
Disallow: /pages/services_pmptraining.html
Disallow: /pages/services_pmptraining_coursestructure.html
Disallow: /pages/services_pmptraining_pmpexam.html
Disallow: /pages/services_pmptraining_pmpbenefits.html
Disallow: /pages/services_pmptraining-testimonials.html
Disallow: /pages/LSPMPTraining.aspx
Disallow: /pages/services_trainingnassessment.html
Disallow: /pages/ourapproach_projectmanagementprocesses.html
Disallow: /pages/ourapproach_contentdevelopment.html
Disallow: /pages/ourapproach_communicationwithclients.html
Disallow: /pages/ourapproach_team.html
Disallow: /pages/ourapproach_qualityassurance.html
Disallow: /pages/showcase_casestudies.html
Disallow: /pages/showcase_casestudies_automobiles01.html
Disallow: /pages/showcase_casestudies_automobiles02.html
Disallow: /pages/showcase_casestudies_bfsi01.html
Disallow: /pages/showcase_casestudies_bfsi02.html
Disallow: /pages/showcase_casestudies_bfsi03.html
Disallow: /pages/showcase_casestudies_education01.html
Disallow: /pages/showcase_casestudies_education02.html
Disallow: /pages/showcase_casestudies_education03.html
Disallow: /pages/showcase_casestudies_education04.html
Disallow: /pages/showcase_casestudies_informationtechnology01.html
Disallow: /pages/showcase_casestudies_telecom01.html
Disallow: /pages/showcase_casestudies_diversified01.html
Disallow: /pages/showcase_casestudies_retail01.html
Disallow: /pages/showcase_casestudies_engineering01.html
Disallow: /pages/contactus_locations.html
Disallow: /pages/Request.aspx
Disallow: /pages/disclaimer.html
Disallow: /pages/apex_award_2010.html
Disallow: /pages/showcase.html
Disallow: /index.html/pages/Request.aspx
Disallow: /index.html/pages/apex.html
Disallow: /index.html/pages/apex_award_2010.html
Disallow: /index.html/pages/services_pmptraining.html
Disallow: /VoteForVictory/index.html
Disallow: /pages/product-demo/index.html
Disallow: /pages/product-demo/illustration.html
Disallow: /pages/product-demo/animation.html
Disallow: /pages/product-demo/emulation.html
Disallow: /pages/product-demo/simulation.html
Disallow: /pages/product-demo/game-based.html
Disallow: /pages/product-demo/assessment.html
Disallow: /artifact/Login.aspx
Disallow: /pages/product-demo/register.html
Disallow: /product-demo/anatomy-study/cbt/index.html
Disallow: /general-awareness-on-h1n1-2009/index.html
Disallow: /general-awareness-on-h1n1-2009/course/index.htm
Disallow: /pages/product-demo/contactus_save.asp
Disallow: /pages/LSPMPTraining
Disallow: /pages/apex.html
Disallow: /aboutus_aboutaptechlearningservices.html
Disallow: /product-demo/screens/animation/demo1.jpg
Disallow: /product-demo/screens/animation/demo2.jpg
Disallow: /product-demo/screens/animation/demo3.jpg
Disallow: /product-demo/screens/animation/demo4.jpg
Disallow: /product-demo/screens/animation/demo5.jpg
Disallow: /product-demo/screens/animation/demo6.jpg
Disallow: /product-demo/screens/animation/demo7.jpg
Disallow: /product-demo/screens/emulation/demo1.jpg
Disallow: /product-demo/screens/emulation/demo2.jpg
Disallow: /product-demo/screens/emulation/demo3.jpg
Disallow: /product-demo/screens/emulation/demo4.jpg
Disallow: /product-demo/screens/emulation/demo5.jpg
Disallow: /product-demo/screens/simulation/demo1.jpg
Disallow: /product-demo/screens/simulation/demo2.jpg
Disallow: /product-demo/screens/simulation/demo3.jpg
Disallow: /product-demo/screens/simulation/demo4.jpg
Disallow: /product-demo/screens/simulation/demo5.jpg
Disallow: /product-demo/screens/game-based/demo1.jpg
Disallow: /product-demo/screens/game-based/demo2.jpg
Disallow: /product-demo/screens/game-based/demo3.jpg
Disallow: /product-demo/screens/game-based/demo4.jpg
Disallow: /product-demo/screens/assessment/demo1.jpg
Disallow: /product-demo/screens/assessment/demo2.jpg
Disallow: /product-demo/screens/assessment/demo3.jpg
Disallow: /product-demo/screens/assessment/demo4.jpg
Disallow: /product-demo/screens/assessment/demo5.jpg
Disallow: /product-demo/screens/illustration/demo1.jpg
Disallow: /product-demo/screens/illustration/demo2.jpg
Disallow: /product-demo/screens/illustration/demo3.jpg
Disallow: /product-demo/screens/illustration/demo4.jpg
Disallow: /product-demo/screens/illustration/demo5.jpg
Disallow: /product-demo/screens/illustration/demo6.jpg
Disallow: /product-demo/screens/illustration/demo7.jpg
Disallow: /images/01_hover.gif
Disallow: /images/product-demo/product-demo.jpg
Disallow: /images/favicon/aptech.ic
Disallow: /css/close.gif
Disallow: /css/close_hover.gif
Disallow: /css/prototip_loader.gif
Disallow: /css/close_hover_red.gif
Disallow: /css/classic_toolbar.gif
Disallow: /images/onpix.gif
Disallow: /images/customer.gif
Disallow: /sitemap.xml
Disallow: /images/ls_logo.jpg
Disallow: /Stylesheet.css
Disallow: /style/css.css
Disallow: /css/popup/colorbox.css
Disallow: /css/popup/colorbox-ie.css
Disallow: /js/popup/jquery.colorbox.js
Disallow: /js/popup/jquery.min.js
Disallow: /js/ajax.js
Disallow: /pages/Scripts/AC_RunActiveContent.js
Индия - Ноида - 180.179.206.125
Netmagic Datacenter Mumbai
Netmagic Datacenter
HTTP/1.1 200 OK
Cache-Control: private
Content-Length: 48069
Content-Type: text/html; charset=utf-8
Server: Microsoft-IIS/7.5
X-AspNet-Version: 2.0.50727
X-Powered-By: ASP.NET
Date: Wed, 04 Dec 2019 10:40:19 GMT
Кнопка для анализа сайта в один клик, для установки перетащите ссылку на "Панель закладок"