Возраст домена | 11 лет |
Дата окончания | Истек срок регистрации |
PR | 2 |
ИКС | n/a |
Страниц в Google | 20 |
Страниц в Яндексе | 11 |
Dmoz | Нет |
Яндекс Каталог | Нет |
Alexa Traffic Rank | 9060164 |
Alexa Country | Нет данных |
История изменения показателей | Авторизация |
Идет сбор информации... Обновить
Ausable Valley Grange Farmers Markets
farmers markets, adirondacks
The AuSable Valley Grange Farmers' Markets are the only "producer-only" farmers' markets in the eastern Adirondacks.
UTF-8
24.91 КБ
158
1 158 симв.
981 симв.
Данные предоставлены сервисом semrush
Сайт | Общие фразы | PR | тИЦ | Alexa Rank | Alexa Country | |
---|---|---|---|---|---|---|
lakeplacid.com | 5 | 5 |
0 | 302122 | 102374 | |
lakeplacidnews.com | 5 | 3 |
0 | 2626610 | Нет данных | |
facebook.com | 4 | 9 |
0 | 3 | 3 | |
avcs.org | 4 | 3 |
0 | 8036763 | Нет данных | |
michiganausablevalleyrailroad.com | 2 | 3 |
0 | 15887242 | Нет данных | |
lakeplacidsinfonietta.org | 2 | 4 |
0 | Нет данных | Нет данных | |
lakeplacidarts.org | 2 | 5 |
0 | 3397139 | Нет данных | |
greatschools.org | 2 | 6 |
0 | 11209 | 2312 | |
ausablevalleyinn.com | 2 | 3 |
0 | 16419712 | Нет данных | |
adirondackalmanack.com | 1 | 4 |
0 | 550400 | 168540 | |
Еще 40 сайтов после авторизации |
Данные предоставлены сервисом semrush
Счетчик | Посетители за 24 часа | Просмотры | Просмотров на посетителя |
---|---|---|---|
Google Analytics | Нет доступа | Нет доступа | n/a |
Данные linkpad ( 5 Февраля 2015 ) | |
Количество ссылок на сайт | 19 |
Количество доменов, которые ссылаются на сайт | 10 |
Количество найденных анкоров | 9 |
Исходящие (внешние) ссылки домена | 21 |
Количество доменов, на которые ссылается сайт | 13 |
Количество исходящих анкоров | 14 |
Внешние ссылки главной страницы ( 2 ) | |
facebook.com/ausablevalleygrangefarmersmarkets/ | - |
weebly.com/signup?utm_source=internal&utm_medium=footer | Powered by Create your own unique website with customizable templates. Get Started |
Внутренние ссылки главной страницы ( 7 ) | |
/ | Home |
/vendor-info.html | Register Now! |
/contact.html | CONTACT |
/lake-placid.html | Lake Placid |
/saranac-lake.html | Saranac Lake |
/grange-history.html | Grange History |
/timeline.html | Timeline |
Domain Name: ausablevalleygrangefarmersmarkets.com
Registry Domain ID: 1782433574_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.register.com
Registrar URL: http://www.register.com
Updated Date: 2015-02-27T20:44:41Z
Creation Date: 2013-02-24T19:02:09Z
Registrar Registration Expiration Date: 2017-02-24T19:02:09Z
Registrar: Register.com, Inc.
Registrar IANA ID: 9
Registrar Abuse Contact Email: abuse@web.com
Registrar Abuse Contact Phone: +1.8773812449
Reseller:
Domain Status: clientTransferProhibited http://icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name: Ausable Valley Grange
Registrant Organization:
Registrant Street: 1749 Main St.
Registrant City: Keeseville
Registrant State/Province: NY
Registrant Postal Code: 12944
Registrant Country: US
Registrant Phone: +1.5186452697
Registrant Phone Ext.:
Registrant Fax:
Registrant Fax Ext.:
Registrant Email: ausablegrange@gmail.com
Registry Admin ID:
Admin Name: Ausable Valley Grange
Admin Organization:
Admin Street: 1749 Main St.
Admin City: Keeseville
Admin State/Province: NY
Admin Postal Code: 12944
Admin Country: US
Admin Phone: +1.5186452697
Admin Phone Ext.:
Admin Fax:
Admin Fax Ext.:
Admin Email: ausablegrange@gmail.com
Registry Tech ID:
Tech Name: Ausable Valley Grange
Tech Organization:
Tech Street: 1749 Main St.
Tech City: Keeseville
Tech State/Province: NY
Tech Postal Code: 12944
Tech Country: US
Tech Phone: +1.5186452697
Tech Phone Ext.:
Tech Fax:
Tech Fax Ext.:
Tech Email: ausablegrange@gmail.com
Name Server: dns2.register.com
Name Server: dns1.register.com
>>> Last update of WHOIS database: 2015-02-27T20:44:41Z <<<
For more information on Whois status codes, please visit https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en.
The data in Register.com's WHOIS database is provided to you by
Register.com for information purposes only, that is, to assist you in
obtaining information about or related to a domain name registration
record. Register.com makes this information available "as is," and
does not guarantee its accuracy. By submitting a WHOIS query, you
agree that you will use this data only for lawful purposes and that,
under no circumstances will you use this data to: (1) allow, enable,
or otherwise support the transmission of mass unsolicited, commercial
advertising or solicitations via direct mail, electronic mail, or by
telephone; or (2) enable high volume, automated, electronic processes
that apply to Register.com (or its systems). The compilation,
repackaging, dissemination or other use of this data is expressly
prohibited without the prior written consent of Register.com.
Register.com reserves the right to modify these terms at any time.
By submitting this query, you agree to abide by these terms.
Sitemap: https://www.AusableValleyGrangeFarmersMarkets.com/sitemap.xml
User-agent: NerdyBot
Disallow: /
User-agent: *
Disallow: /ajax/
Disallow: /apps/
США - 174.122.110.220
Softlayer
ThePlanet.com Internet Services
HTTP/1.1 200 OK
Date: Sun, 01 Dec 2019 01:30:13 GMT
Server: Apache
Set-Cookie: is_mobile=0; path=/; domain=www.ausablevalleygrangefarmersmarkets.com
Vary: X-W-SSL,Accept-Encoding,User-Agent
Set-Cookie: language=en; expires=Sun, 15-Dec-2019 01:30:13 GMT; Max-Age=1209600; path=/
Set-Cookie: gdpr-kb=1; expires=Wed, 28-Nov-2029 01:30:13 GMT; Max-Age=315360000; path=/
Cache-Control: private
ETag: W/"7d0b246809ed9f9d8ac93677c0066e48"
X-Host: pages52.sf2p.intern.weebly.net
X-UA-Compatible: IE=edge,chrome=1
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
Кнопка для анализа сайта в один клик, для установки перетащите ссылку на "Панель закладок"