Возраст домена | n/a |
Дата окончания | n/a |
PR | 1 |
ИКС | 0 |
Страниц в Google | 562 |
Страниц в Яндексе | 48 |
Dmoz | Нет |
Яндекс Каталог | Нет |
Alexa Traffic Rank | 18372757 |
Alexa Country | Нет данных |
История изменения показателей | Авторизация |
Идет сбор информации... Обновить
Bodner Shapiro Law Group, LLC
Russian lawyer, Hartford CT and Springfield MA Car Accident Lawyer, Russian speaking lawyer, Western Massachusetts, Springfield, Westfield, Chicopee, Hartford, Connecticut, Russian speaking attorney, Russian attorney, speaks Russian, personal injury, car accident, divorce, probate, will, power of attorney, commercial, contracts, negotiations, criminal, DUI, OUI, driving under influence, operating under influence, lawyer fluent in Russian, attorney fluent in Russian, Russian, lawyer, attorney, la
Hartford CT and Springfield MA Car Accident Lawyer, Russian lawyer, Russian speaking lawyer, Western Massachusetts, Springfield, Westfield, Chicopee, Hartford, Connecticut
UTF-8
8.62 КБ
363
2 869 симв.
2 447 симв.
Данные предоставлены сервисом semrush
Сайт | Общие фразы | PR | тИЦ | Alexa Rank | Alexa Country | |
---|---|---|---|---|---|---|
![]() ![]() |
6 | 7 |
0 | 58266 | ![]() | |
![]() |
6 | n/a | 0 | 109662 | ![]() | |
![]() ![]() |
6 | 6 |
60 | 21301 | ![]() | |
![]() ![]() |
6 | 7 |
0 | 29842 | ![]() | |
![]() ![]() |
6 | 6 |
0 | 7004 | ![]() | |
![]() |
5 | 7 |
0 | 494 | ![]() | |
![]() |
5 | 5 |
0 | 64203 | ![]() | |
![]() ![]() |
5 | 9 |
0 | 3 | ![]() | |
![]() ![]() |
4 | 6 |
0 | 1140480 | ![]() | |
![]() ![]() |
4 | 7 |
0 | 5996 | ![]() | |
Еще 40 сайтов после авторизации |
Данные предоставлены сервисом semrush
Счетчик | Посетители за 24 часа | Просмотры | Просмотров на посетителя |
---|---|---|---|
![]() | Нет доступа | Нет доступа | n/a |
Данные linkpad ( 13 Сентября 2014 ) | |
Количество ссылок на сайт | 26 |
Количество доменов, которые ссылаются на сайт | 8 |
Количество найденных анкоров | 9 |
Исходящие (внешние) ссылки домена | 16 |
Количество доменов, на которые ссылается сайт | 5 |
Количество исходящих анкоров | 7 |
Внешние ссылки главной страницы ( 3 ) | |
hartfordctcaraccidentlawyer.com | Connecticut |
springfieldmacaraccidentlawyer.com | Massachusetts |
connecticutcs.com | Computer Solutions |
Внутренние ссылки главной страницы ( 11 ) | |
index.php | Home |
# | Services |
personal_injury.php | Personal Injury, |
estate_planning.php | Estate Planning |
family_law.php | Family Law |
business-law.php | Business / Commercial Law |
bio.php | Biography |
contact.php | here |
index-rus.php | РУССКИЙ |
Areas_We_Service.php | Areas We Service List. |
discount_coupon.php | <img> |
Domain Name: BODNERSHAPIRO.COM
Registrar URL: http://www.wildwestdomains.com
Registrant Name: Polina Bodner
Registrant Organization:
Name Server: NS71.DOMAINCONTROL.COM
Name Server: NS72.DOMAINCONTROL.COM
For complete domain details go to:
http://who.securepaynet.net/whoischeck.aspx?domain=BODNERSHAPIRO.COM&prog_id=370121
The data contained in this Registrar's Whois database,
while believed by the registrar to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This information
is provided for the sole purpose of assisting you in obtaining
information about domain name registration records. Any use of
this data for any other purpose is expressly forbidden without
the prior written permission of this registrar. By submitting an
inquiry, you agree to these terms of usage and limitations of warranty.
In particular, you agree not to use this data to allow, enable, or
otherwise make possible, dissemination or collection of this data, in
part or in its entirety, for any purpose, such as the transmission of
unsolicited advertising and solicitations of any kind, including spam.
You further agree not to use this data to enable high volume, automated
or robotic electronic processes designed to collect or compile this data
for any purpose, including mining this data for your own personal or
commercial purposes.
Please note: the owner of the domain name is specified in the "registrant" section.
In most cases, the Registrar is not the owner of domain names listed in this database.
США - Сан-Хосе - 66.35.204.10
Savvis
Savvis
HTTP/1.1 200 OK
Date: Wed, 25 Dec 2019 11:36:14 GMT
Server: Apache
Vary: Accept-Encoding
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
Кнопка для анализа сайта в один клик, для установки перетащите ссылку на "Панель закладок"