Возраст домена | 15 лет |
Дата окончания | Истек срок регистрации |
PR | 3 |
ИКС | |
Страниц в Google | 11 |
Страниц в Яндексе | 5 |
Dmoz | Нет |
Яндекс Каталог | Нет |
Alexa Traffic Rank | Нет данных |
Alexa Country | Нет данных |
История изменения показателей | Авторизация |
Идет сбор информации... Обновить
Clean Sweep Chimney Sweeps, Inc. offers certified services to Northern OH
chimneysweep, chimneysweeps, chimney service, chimney services, chimney cleaning, chimney inspections, chimney repair, NCSG, CSIA, FIRE, Vermilion, OH, Clean Sweep Chimney Sweeps, Inc., Rick Comstock
For over 20 years, Clean Sweep Chimney Sweeps, Inc. has served Vermilion and the surrounding region with certified, professional cleaning, inspection and repair services; member CSIA, NFPA, FIRE
UTF-8
7.37 КБ
541
3 940 симв.
3 290 симв.
Данные предоставлены сервисом semrush
Сайт | Общие фразы | PR | тИЦ | Alexa Rank | Alexa Country | |
---|---|---|---|---|---|---|
cleansweepchimneyservice.com | 5 | 1 |
0 | 24090336 | Нет данных | |
cleansweepal.com | 5 | n/a | 0 | Нет данных | Нет данных | |
acleansweep.org | 5 | 1 |
0 | 17420221 | Нет данных | |
southshorechimney.com | 5 | 1 |
0 | Нет данных | Нет данных | |
thecleansweepchimney.com | 5 | n/a | 0 | Нет данных | Нет данных | |
certifiedchimneyprofessionals.com | 5 | 2 |
0 | 17222805 | Нет данных | |
cleansweep-chimney.com | 4 | n/a | 0 | Нет данных | Нет данных | |
cleansweepchimneyservices.biz | 4 | n/a | 0 | Нет данных | Нет данных | |
cleansweepchimneyandheatingservice.com | 4 | 1 |
0 | 21533460 | Нет данных | |
cleansweepchimneyservicesllc.com | 3 | n/a | 0 | Нет данных | Нет данных | |
Еще 40 сайтов после авторизации |
Данные предоставлены сервисом semrush
Данные linkpad ( 10 Февраля 2015 ) | |
Количество ссылок на сайт | 1 |
Количество доменов, которые ссылаются на сайт | 1 |
Количество найденных анкоров | 1 |
Исходящие (внешние) ссылки домена | 19 |
Количество доменов, на которые ссылается сайт | 8 |
Количество исходящих анкоров | 11 |
Внешние ссылки главной страницы ( 4 ) | |
f-i-r-e-service.com/ | Fireplace Investigation, Research and Education (F.I.R.E.) |
nfpa.org/ | NFPA standards |
markethardware.com/verticals/chimney-sweeps/?src=home-servic... | Websites and SEO for Chimney Industry Professionals |
markethardware.com/ | Market Hardware |
Внутренние ссылки главной страницы ( 7 ) | |
/ | Home |
/services.php | Our Services |
/affiliations.php | Affiliations |
/when-i-arrive.php | See the Difference... |
/testimonials.php | Testimonials |
/contact.php | Get in Touch |
../../../../contact.php | call Rick |
Domain names in the .com and .net domains can now be registered
with many different competing registrars. Go to http://www.internic.net
for detailed information.
Domain Name: CALLCLEANSWEEP.COM
Registrar: ENOM, INC.
Sponsoring Registrar IANA ID: 48
Whois Server: whois.enom.com
Referral URL: http://www.enom.com
Name Server: NS5.MARKETHARDWARE.COM
Name Server: NS6.MARKETHARDWARE.COM
Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited
Updated Date: 15-dec-2015
Creation Date: 15-apr-2009
Expiration Date: 15-apr-2016
>>> Last update of whois database: Thu, 10 Mar 2016 17:49:49 GMT <<<
For more information on Whois status codes, please visit https://icann.org/epp
NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar. Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.
TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.
The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.
Domain Name: CALLCLEANSWEEP.COM
Registry Domain ID: 1552387413_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.enom.com
Registrar URL: www.enom.com
Updated Date: 2016-03-02T04:39:39.00Z
Creation Date: 2009-04-15T18:52:51.00Z
Registrar Registration Expiration Date: 2016-04-15T18:52:51.00Z
Registrar: ENOM, INC.
Registrar IANA ID: 48
Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name: RICK COMSTOCK
Registrant Organization: CLEAN SWEEP CHIMNEY SWEEPS, INC.
Registrant Street: N/A
Registrant City: VERMILLION
Registrant State/Province: OH
Registrant Postal Code: 44089
Registrant Country: US
Registrant Phone: +1.8883816925
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: DOMAINS@MARKETHARDWARE.COM
Registry Admin ID:
Admin Name: MARKET HARDWARE TECHNICAL
Admin Organization: MARKET HARDWARE
Admin Street: 7200 WISCONSIN AVENUE
Admin Street: SUITE 312
Admin City: BETHESDA
Admin State/Province:
Admin Postal Code: 20814
Admin Country:
Admin Phone: +1.8883816925
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: DOMAINS@MARKETHARDWARE.COM
Registry Tech ID:
Tech Name: MARKET HARDWARE TECHNICAL
Tech Organization: MARKET HARDWARE
Tech Street: 7200 WISCONSIN AVENUE
Tech Street: SUITE 312
Tech City: BETHESDA
Tech State/Province:
Tech Postal Code: 20814
Tech Country:
Tech Phone: +1.8883816925
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: DOMAINS@MARKETHARDWARE.COM
Name Server: NS5.MARKETHARDWARE.COM
Name Server: NS6.MARKETHARDWARE.COM
Registrar Abuse Contact Email: abuse@enom.com
Registrar Abuse Contact Phone: +1.4252982646
Last update of WHOIS database: 2016-03-02T04:39:39.00Z
User-agent: *
Disallow: /common/
Disallow: /review/
Disallow: /404.html
Disallow: /404.php
США - 216.70.123.129
Media Temple
Media Temple
HTTP/1.1 200 OK
Date: Mon, 13 Jan 2020 15:51:18 GMT
Server: Apache
Vary: Host,Accept-Encoding
X-Powered-By: PHP/5.3.10-1ubuntu3.26
Set-Cookie: PHPSESSID=p497juft1uekto8vsm8i2tni31; path=/
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Set-Cookie: PHPSESSID=p497juft1uekto8vsm8i2tni31; path=/; httponly
Content-Length: 7546
Content-Type: text/html
Кнопка для анализа сайта в один клик, для установки перетащите ссылку на "Панель закладок"