Возраст домена | 24 года |
Дата окончания | Истек срок регистрации |
PR | 4 |
ИКС | 10 |
Страниц в Google | 408 |
Страниц в Яндексе | 195 |
Dmoz | ![]() |
Яндекс Каталог | Нет |
Alexa Traffic Rank | 233519 |
Alexa Country | ![]() |
История изменения показателей | Авторизация |
Идет сбор информации... Обновить
Cook County Treasurer's Office - Chicago, Illinois
n/a
n/a
UTF-8
150.93 КБ
1 093
8 047 симв.
6 832 симв.
Данные предоставлены сервисом semrush
Сайт | Общие фразы | PR | тИЦ | Alexa Rank | Alexa Country | |
---|---|---|---|---|---|---|
![]() |
475 | 5 |
0 | 335333 | ![]() | |
![]() ![]() |
465 | 5 |
0 | 184992 | ![]() | |
![]() ![]() |
349 | 5 |
0 | 103349 | ![]() | |
![]() ![]() |
309 | 5 |
0 | 172865 | ![]() | |
![]() |
270 | 4 |
0 | 162539 | ![]() | |
![]() |
195 | 5 |
0 | 330453 | ![]() | |
![]() ![]() |
192 | 4 |
0 | 218729 | ![]() | |
![]() |
172 | n/a | 0 | 2955695 | ![]() |
|
![]() |
165 | 4 |
0 | 519780 | ![]() | |
![]() |
107 | 4 |
0 | 1073313 | ![]() | |
![]() ![]() |
4 | 7 |
0 | 128 | ![]() | |
![]() ![]() |
3 | 8 |
0 | 278 | ![]() | |
![]() ![]() |
3 | 6 |
10 | 261604 | ![]() | |
![]() |
2 | 4 |
0 | 138494 | ![]() | |
![]() ![]() |
2 | 7 |
0 | 4869 | ![]() | |
![]() ![]() |
1 | 4 |
0 | 1420644 | ![]() | |
![]() ![]() |
1 | 7 |
0 | 4616 | ![]() | |
![]() |
1 | 4 |
0 | 404357 | ![]() | |
![]() ![]() |
1 | 6 |
0 | 84351 | ![]() | |
Еще 31 сайт после авторизации |
Данные предоставлены сервисом semrush
Данные linkpad ( 10 Ноября 2016 ) | |
Количество ссылок на сайт | 1770 |
Количество доменов, которые ссылаются на сайт | 408 |
Количество найденных анкоров | 144 |
Исходящие (внешние) ссылки домена | 3921 |
Количество доменов, на которые ссылается сайт | 26 |
Количество исходящих анкоров | 31 |
Внешние ссылки главной страницы ( 13 ) | |
cookcountytpa.com/ | Single or Multiple Payments Via ACH |
facebook.com/cookcountytreasurer | <img> |
youtube.com/channel/UCp8Om8JEUhl_j99qREPehVg | <img> |
cookcountyil.gov/ | Cook County Government |
cookcountyassessor.com/ | County Assessor |
cookcountyboardofreview.com/ | Board of Review |
cookcountyclerk.com/ | County Clerk |
cookrecorder.com/ | Recorder of Deeds |
cookcountypropertyinfo.com/ | Cook County Property Tax Portal |
texthelp.com/en-us | Browse Aloud |
translate.google.com/ | Google™ Translate |
dhs.state.il.us/iitaa | Illinois Information Technology Accessibility Act |
ada.gov/ | Americans with Disabilities Act |
Внутренние ссылки главной страницы ( 58 ) | |
default.aspx | <img> |
yourpropertytaxoverviewsearch.aspx | Check Your Payment Status or Make an Online Payment |
makingpaymentsbymailorinperson.aspx | Pay By Mail or In Person |
makingpaymentsatchasebank.aspx | Pay At Chase Bank |
communitybank.aspx | Pay At Your Local Community Bank |
requestaduplicatetaxbillsearch.aspx | Get a Copy of Your Tax Bill |
returnedchecks.aspx | Returned Checks |
prioryears.aspx | Information about Prior Year Property Taxes |
prepayment.aspx | Paying First Installment Property Taxes Early |
iftaxesweresold.aspx | If Taxes Were Sold |
makingmultiplepaymentsviawiretransfer.aspx | Multiple Payments Via Wire Transfer |
exemptionhistorysearch.aspx | Exemption History Search |
seniorexemptionspropertylist.aspx | Lists of Properties Missing Senior Exemptions |
homeownerexemption.aspx | Homeowner Exemption |
seniorcitizenhomesteadexemption.aspx | Senior Citizen Homestead Exemption |
seniorcitizenassessmentfreezeexemption.aspx | Senior Citizen Assessment Freeze Exemption |
homeimprovement.aspx | Home Improvement Exemption |
currentmilitarywaiverform.aspx | Property Tax Relief for Military Personnel |
disabledveteranhomesteadexemption.aspx | Disabled Veteran Homestead Exemption |
duplicateandoverpaymentrefundsearch.aspx | Overpayment Refund Search |
duplicateandoverpaymentrefundstatussearch.aspx | Overpayment Refund Status Search |
howtoapplyforarefund.aspx | How to Apply for a Property Tax Refund |
uncashedchecksearch.aspx | Uncashed Check Search |
ptabrefundsearch.aspx | Property Tax Appeal Board Refunds |
estatesearch.aspx | Estate Search |
exemptions.aspx | Exemptions |
theseniorcitizenrealestatetaxdeferralprogram.aspx | The Senior Citizen Real Estate Tax Deferral Program |
thirdpartynotification.aspx | Third-Party Notification |
understandingyourtaxbill.aspx | Understanding Your Bill |
aboutyourpin.aspx | About Your Property Index Number (PIN) |
nameoraddresschangesearch.aspx | Update Your Name or Mailing Address |
monitoringyourmortgage.aspx | Monitoring Your Mortgage |
taxingdistrictssearch.aspx | Taxing Districts' Financial Statements and Disclosures |
accountsignin.aspx | Sign In to Your Electronic Billing Account |
delinquentpropertytaxsearch.aspx | Avoid the Tax Year 2018 Annual Tax Sale |
annualtaxsaleresults.aspx | Search Tax Year 2015-2017 Annual Tax Sale Results |
pamphlets.aspx?language=english | Foreign Language Brochures |
duplicateoroverpaymentrefundform.aspx | Duplicate or Overpayment Refund |
propertytaxappealboardrefundform.aspx | Property Tax Appeal Board Refunds |
certificateoferrorrefundform.aspx | Certificate of Error Refund |
thirdpartynotificationform.aspx | Third Party Notification Request |
freedomofinformationrequestform.aspx | Freedom of Information Act (FOIA) Request |
dutiesandresponsibilities.aspx | Duties and Responsibilities of the Cook County Treasurer |
treasurersbiography.aspx | Maria Pappas, Cook County Treasurer's Biography |
treasurersresume.aspx | Maria Pappas, Cook County Treasurer's Resume |
freedomofinformationact.aspx | Freedom of Information Requests |
stateoftheoffice.aspx | State of the Office |
newsandvideos.aspx | Search the News and Video Library |
duedates.aspx | Important Dates |
disclaimer.aspx | Disclaimer of Liability |
signupforemailnotifications.aspx | Sign Up for Email Notifications |
officehours.aspx | Office Hours |
contactusbyphone.aspx | Contact Us by Phone |
contactusbyemail.aspx | Contact Us by Email |
signupforelectronicbilling.aspx | Sign Up for Electronic Tax Billing |
researchatopic.aspx | Research a Topic |
cookcountytreasurer.com/ | County Treasurer |
languagetranslationservicedisclaimer.aspx | Language Translation Service Disclaimer |
Domain Name: COOKCOUNTYTREASURER.COM
Registry Domain ID: 19835740_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.networksolutions.com
Registrar URL: http://networksolutions.com
Updated Date: 2017-12-19T20:37:24Z
Creation Date: 2000-02-14T19:49:08Z
Registrar Registration Expiration Date: 2024-02-14T19:49:08Z
Registrar: NETWORK SOLUTIONS, LLC.
Registrar IANA ID: 2
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name: PERFECT PRIVACY, LLC
Registrant Organization:
Registrant Street: 12808 Gran Bay Parkway West
Registrant City: Jacksonville
Registrant State/Province: FL
Registrant Postal Code: 32258
Registrant Country: US
Registrant Phone: +1.5707088780
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: zr6x44yd8wk@networksolutionsprivateregistration.com
Registry Admin ID:
Admin Name: PERFECT PRIVACY, LLC
Admin Organization:
Admin Street: 12808 Gran Bay Parkway West
Admin City: Jacksonville
Admin State/Province: FL
Admin Postal Code: 32258
Admin Country: US
Admin Phone: +1.5707088780
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: zr6x44yd8wk@networksolutionsprivateregistration.com
Registry Tech ID:
Tech Name: PERFECT PRIVACY, LLC
Tech Organization:
Tech Street: 12808 Gran Bay Parkway West
Tech City: Jacksonville
Tech State/Province: FL
Tech Postal Code: 32258
Tech Country: US
Tech Phone: +1.5707088780
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: h89n53k58uj@networksolutionsprivateregistration.com
Name Server: NS1.SERVERCENTRAL.NET
Name Server: NS2.SERVERCENTRAL.NET
Name Server: NS3.SERVERCENTRAL.NET
Registrar Abuse Contact Email: abuse@web.com
Registrar Abuse Contact Phone: +1.8003337680
>>> Last update of WHOIS database: 2018-12-14T16:34:45Z <<<
For more information on Whois status codes, please visit https: //www.icann.org/resources/pages/epp-status-codes-2014-06-16-en
This listing is a Network Solutions Private Registration. Mail
correspondence to this address must be sent via USPS Express Mail(TM) or
USPS Certified Mail(R); all other mail will not be processed. Be sure to
include the registrant's domain name in the address.
США - Окленд - 166.107.72.47
Alameda County
Alameda County
HTTP/1.1 200 OK
Cache-Control: private
Content-Type: text/html; charset=utf-8
Server: Microsoft-IIS/10.0
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
Date: Thu, 09 Jan 2020 04:20:07 GMT
Content-Length: 154552
Кнопка для анализа сайта в один клик, для установки перетащите ссылку на "Панель закладок"