Возраст домена | 20 лет |
Дата окончания | Истек срок регистрации |
PR | 1 |
ИКС | n/a |
Страниц в Google | 90 |
Страниц в Яндексе | 93 |
Dmoz | Нет |
Яндекс Каталог | Нет |
Alexa Traffic Rank | 13937699 |
Alexa Country | Нет данных |
История изменения показателей | Авторизация |
Идет сбор информации... Обновить
Crystal Gifts Engraved - Glass & Crystal Products
art glass, glass crystal Krystoff, Krystof trophies trophy awards award plaques plaque recognition medals medal soccer ribbons ribbon engraving engraved engrave gifts gift new hampshire laconia concord vermont maine nh vt me ma mass massachusetts new england gavels gavel ceremonial memorial perpetual custom signs promotional products engraver engravings engravers plastic wood acrylics corporate personalize personalized personalizing advertising specialties certificates cast bronze nameplates nam
We design and produce customized engraved glass, crystal, awards, trophies, plaques, ribbons, gifts, medals, signage, promotional products and special recognition items.
UTF-8
33.63 КБ
578
4 230 симв.
3 596 симв.
Данные предоставлены сервисом semrush
Сайт | Общие фразы | PR | тИЦ | Alexa Rank | Alexa Country | |
---|---|---|---|---|---|---|
![]() |
7 | 2 |
0 | 8945379 | ![]() |
|
![]() ![]() |
6 | 4 |
10 | 215795 | ![]() | |
![]() ![]() |
6 | 5 |
0 | 126020 | ![]() | |
![]() ![]() |
6 | 1 |
0 | 3287043 | ![]() |
|
![]() ![]() |
6 | 4 |
10 | 333719 | ![]() | |
![]() |
5 | 1 |
0 | 15878598 | ![]() |
|
![]() |
5 | n/a | 0 | 13533262 | ![]() |
|
![]() |
5 | 1 |
0 | 15623132 | ![]() |
|
![]() ![]() |
5 | 3 |
0 | 2559209 | ![]() |
|
![]() |
5 | 2 |
0 | 1029858 | ![]() | |
Еще 27 сайтов после авторизации |
Данные предоставлены сервисом semrush
Счетчик | Посетители за 24 часа | Просмотры | Просмотров на посетителя |
---|---|---|---|
![]() | Нет доступа | Нет доступа | n/a |
Данные linkpad ( 8 Ноября 2014 ) | |
Количество ссылок на сайт | 37 |
Количество доменов, которые ссылаются на сайт | 14 |
Количество найденных анкоров | 6 |
Исходящие (внешние) ссылки домена | 126 |
Количество доменов, на которые ссылается сайт | 37 |
Количество исходящих анкоров | 3 |
Внешние ссылки главной страницы ( 3 ) | |
eag.espwebsite.com/ | See Our Promotional Products Selection! |
EngravingAwardsGifts.com | www.EngravingAwardsGifts.com |
statcounter.com | <img> |
Внутренние ссылки главной страницы ( 89 ) | |
howtoorder.html | an Order |
crystalgiftsengravedshipping.html | Information |
aboutcrystal.html | Facts |
crystalgiftsengravedtestimonials.html | Testimonials |
graphicdesigncrystalgiftsengraved.html | Design |
crystalgiftsengravedmember.html | Affiliations |
crystaleggartglassawards.html | Art Glass Eggs |
crystalhandblownartglassawards.html | Hand Blown Art Glass |
crystaldesignerartglassawards.html | Designer Art Glass Awards |
crystalartglassanimalawards.html | Hand Blown Art Glass Animals |
crystaleliteartglassawards.html | Elite Art Glass Awards |
crystalspheresglobesartglassawards.html | Globes & Spheres |
crystaldesignertrophycups.html | Crystal Designer Trophies |
crystalhandblownartglassawards2.html | Hand Blown Art Glass |
crystaltowersobelisksartglassawards.html | Crystal Towers & Obelisks |
crystalvasesbowlscompotesartglassawards.html | Vases & Compotes |
oxfordartglassawards.html | Oxford Art Glass Awards |
standingartglassgeometricawards.html | Geometric Awards |
standingartglassdiscawards.html | Art Glass Awards |
fractalawards.html | Art Glass Awards |
3dlasercrystalcustomblockawards.html | 3-D Custom Block |
3dlasercrystalglobeawards.html | 3-D Globe Awards |
plaques.html | Crystal Plaques |
standupawards.html | Crystal Stand Up Awards |
curvedglass.html | Curved Glass Awards |
emeraldglass.html | Emerald Glass Awards |
obeliskstowersglassawards.html | Crystal Obelisks & Towers |
diamond.html | Crystal Diamond Awards |
starawards.html | Crystal Star Awards |
bowls.html | Crystal Bowls |
trophycups.html | Crystal Trophy Cups |
vases.html | Crystal Vases |
cobaltcrystal.html | Cobalt Crystal |
standupawardsblueopticalcrystal.html | Crystal Awards |
baseball.html | Baseball Awards |
basketball.html | Basketball Awards |
bowling.html | Bowling Awards |
boxing.html | Boxing Awards |
football.html | Football Awards |
golf.html | Golf Awards |
crystalsailingawards.html | Sailing Awards |
soccer.html | Soccer Awards |
tennis.html | Tennis Awards |
crystalartglassawards.html | Art Glass Awards |
flags.html | Crystal Flag Awards |
inukshukawards.html | Inukshuk Awards & Gifts |
globes.html | Crystal Globes |
storybookcrystal.html | Storybook Crystal |
eagles.html | All Crystal Eagles |
leadcrystalanimalawards.html | Lead Crystal Animals |
leadcrystaleagleawards.html | Lead Crystal Eagles |
castmetalartglassawards.html | Art Glass Cast Metal Awards |
crystalsportsawards.html | Crystal Sports Awards |
2dcrystaltransportationawards.html | 2-D Transportation Awards |
3dcrystaltransportationawards.html | 3-D Transportation Awards |
2dstockdesignawards.html | 2-D Stock Design Awards |
2dcustomdesignawards.html | 2-D Awards: Custom |
3dcustomdesignawards.html | Custom 3-D Awards |
2dcrystalgamingawards.html | Crystal Gaming Awards |
2dcrystaloildrillingthemeawards.html | Crystal Oil Drilling Awards |
apples.html | Crystal Apples |
books.html | Crystal Books |
boxes.html | Crystal Boxes |
clocks.html | Crystal Clocks |
desksetitems.html | Crystal Desk Set Items |
hearts.html | Crystal Hearts |
paperweights.html | Crystal Paperweights |
pictureframes.html | Crystal Picture Frames |
crystalmugsandtankards.html | Crystal Mugs & Tankards |
decanters.html | Crystal Decanters |
icebuckets.html | Crystal Ice Buckets |
glasswaresets.html | Glassware Sets |
hurricanelamps.html | Crystal Candle Holders |
stemware.html | Stemware |
bottlestoppers.html | Bottle Stoppers |
pitchers.html | Crystal Pitchers |
platesandplatters.html | Crystal Plates & Platters |
carafes.html | Crystal Carafes |
glassware.html | Glassware |
canisters.html | Coasters |
coasters.html | <img> |
ornaments.html | Crystal Ornaments |
ornaments-fullcolor.html | Full Color Ornaments |
ceramicmugsandtankards.html | Ceramic Mugs |
marble.html | Marble Products |
silvertraysbowls.html | Silver Plates & Trays |
executivegifts.html | Executive Gifts |
noncrystaleagles.html | Non-Crystal & Cast Eagles |
woodgifts.html | Wood Gifts |
Domain Name: crystalgiftsengraved.com
Registry Domain ID: 109611739_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.melbourneit.com
Registrar URL: http://www.melbourneit.com.au
Updated Date: 2014-01-07T23:09:10Z
Creation Date: 2004-01-09T17:56:26Z
Registrar Registration Expiration Date: 2015-01-10T04:56:26Z
Registrar: Melbourne IT Ltd
Registrar IANA ID: 13
Registrar Abuse Contact Email: abuse@melbourneit.com.au
Registrar Abuse Contact Phone: +61.386242300
Domain Status: clientTransferProhibited
Registry Registrant ID:
Registrant Name: Dana Powers
Registrant Organization: Engraving, Awards & Gifts
Registrant Street: 42 Franklin Street
Registrant City: Laconia
Registrant State/Province: NH
Registrant Postal Code: 03246
Registrant Country: US
Registrant Phone: +1.8002309588
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: webmaster@engravingawardsgifts.com
Registry Admin ID:
Admin Name: Dana Powers
Admin Organization: Engraving, Awards & Gifts
Admin Street: 42 Franklin Street
Admin City: Laconia
Admin State/Province: NH
Admin Postal Code: 03246
Admin Country: US
Admin Phone: +1.8002309588
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: webmaster@engravingawardsgifts.com
Registry Tech ID:
Tech Name: Dana Powers
Tech Organization: Engraving, Awards & Gifts
Tech Street: 42 Franklin Street
Tech City: Laconia
Tech State/Province: NH
Tech Postal Code: 03246
Tech Country: US
Tech Phone: +1.8002309588
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: webmaster@engravingawardsgifts.com
Name Server: NS1.SECURE.NET
Name Server: NS2.SECURE.NET
>>> Last update of WHOIS database: 2015-01-03T05:09:07Z
TERMS OF USE OF MELBOURNE IT WHOIS DATABASE
The WHOIS database is operated by Melbourne IT Ltd ('we', 'our' or 'us'). Your access to, and use of, our WHOIS database and the information made available on our WHOIS database is subject to these Terms of Use and our Privacy Policy. All information contained in our WHOIS database is provided 'as is'. We take no responsibility for any error or omission in our WHOIS database. The data in our WHOIS database is provided to you for your information only. You may use the information in our WHOIS database only for the purpose of obtaining information about or related to a domain name registration record ('Permitted Purpose'). You agree not to use high-volume, automated electronic processes to access or query our WHOIS database. By submitting a WHOIS query to us, you agree that you will only use the data obtained from a WHOIS query for the Permitted Purpose and for lawful purposes, and that you will not: (a) allow, enable, or otherwise support the transmission of mass, unsolicited, commercial advertising or solicitations by e-mail, telephone, or facsimile; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of any Registry Operator or ICANN-Accredited registrar, except as reasonably necessary to register domain names or modify existing domain name registrations. You also agree that the copying, reproduction, translation, compilation, re-packaging, dissemination or other use of the data in our WHOIS database is prohibited without our prior written consent. We reserve the right to terminate your access to our WHOIS database at any time, and for any reason, including (without limitation) if you fail to comply with any provision of these Terms of Use, or we consider that you are excessively querying our WHOIS database. These Terms of Use may be modified by us at any time without notice by our amending the Terms of Use on this web page. You agree that your use of our WHOIS database following any modification to these Terms of Use will constitute your acceptance of these Terms of Use (as modified from time to time).
США - 72.167.35.108
GoDaddy.com, LLC
GoDaddy.com, LLC
HTTP/1.1 200 OK
Date: Thu, 14 Mar 2019 00:06:47 GMT
Server: Apache
Last-Modified: Mon, 28 May 2018 13:58:50 GMT
Accept-Ranges: bytes
Content-Length: 34432
Connection: close
Content-Type: text/html
Кнопка для анализа сайта в один клик, для установки перетащите ссылку на "Панель закладок"