Возраст домена | 12 лет |
Дата окончания | Истек срок регистрации |
PR | 2 |
ИКС | 0 |
Страниц в Google | 67 |
Страниц в Яндексе | 97 |
Dmoz | Нет |
Яндекс Каталог | Нет |
Alexa Traffic Rank | 8135560 |
Alexa Country | Нет данных |
История изменения показателей | Авторизация |
Идет сбор информации... Обновить
DAFTHACK
n/a
A security blog by Beau Bullock.
UTF-8
44.35 КБ
1 335
10 553 симв.
8 831 симв.
Данные предоставлены сервисом semrush
Сайт | Общие фразы | PR | тИЦ | Alexa Rank | Alexa Country | |
---|---|---|---|---|---|---|
youtube.com | 39 | 9 |
0 | 2 | 2 | |
acehackware.com | 16 | 4 |
0 | 1575594 | 516119 | |
lifehacker.com | 14 | 7 |
0 | 1152 | 345 | |
lockpickersmall.com | 13 | 2 |
0 | 2490374 | Нет данных | |
amazon.com | 11 | 8 |
0 | 10 | 4 | |
offensive-security.com | 11 | 5 |
0 | 24433 | 16830 | |
lockpickshop.com | 9 | 3 |
10 | 307730 | 64290 | |
lockpicking101.com | 9 | 4 |
10 | 690423 | 295641 | |
gregmiller.net | 9 | 3 |
0 | 1908336 | 510760 | |
ebay.com | 9 | 8 |
0 | 42 | 11 | |
vmware.com | 4 | 7 |
0 | 1525 | 1254 | |
rutracker.org | 2 | 5 |
0 | 268 | 270 | |
linuxuser.co.uk | 2 | 6 |
40 | 17757992 | Нет данных | |
kali.org | 2 | 5 |
0 | 8568 | 3577 | |
hakin9.org | 2 | 6 |
0 | 471350 | 379256 | |
back-track-linux.blogspot.com | 2 | 1 |
0 | 3727882 | Нет данных | |
backtrack-linux.org | 2 | 6 |
0 | 237834 | 119203 | |
backtracktutorials.com | 2 | 1 |
0 | 566569 | 108666 | |
Еще 32 сайта после авторизации |
Данные предоставлены сервисом semrush
Данные linkpad ( 18 Апреля 2016 ) | |
Количество ссылок на сайт | 4 |
Количество доменов, которые ссылаются на сайт | 4 |
Количество найденных анкоров | 4 |
Исходящие (внешние) ссылки домена | 0 |
Количество доменов, на которые ссылается сайт | 0 |
Количество исходящих анкоров | 0 |
Внешние ссылки главной страницы ( 8 ) | |
github.com/dafthack/mailsniper | MailSniper |
github.com/dafthack/DomainPasswordSpray | DomainPasswordSpray |
github.com/dafthack/powermeta | PowerMeta |
github.com/dafthack/hostrecon | HostRecon |
twitter.com/dafthack | @dafthack |
eepurl.com/NMKNn | Subscribe |
sites.google.com/a/dafthack.com/dafthack/system/app/pages/re... | Report Abuse |
sites.google.com/site | Google Sites |
Внутренние ссылки главной страницы ( 48 ) | |
/blog | View more » |
/blog/abusingexchangemailboxpermissionswithmailsniper | Abusing Exchange Mailbox Permissions with MailSniper |
/blog/hostreconasituationalawarenesstool | HostRecon: A Situational Awareness Tool |
/blog/bypassingtwo-factorauthenticationonowaandoffice365port... | Bypassing Two-Factor Authentication on OWA and Office365 Portals |
/blog/introducingmailsniperatoolforsearchingeveryusersemailf... | Introducing MailSniper: A Tool For Searching Every User's Email for Sensitive Data |
/blog/howtobuildyourownpenetrationtestingdropbox | How to Build Your Own Penetration Testing Drop Box |
/blog/stormchasinghowwehackedyourcloud | Storm Chasing: How We Hacked Your Cloud |
dafthack.com/blog/pokingholesinthefirewallegresstestingwitha... | HERE |
/blog/reviewkalilinuxwebpenetrationtestingcookbook | REVIEW: Kali Linux Web Penetration Testing Cookbook |
/blog/passwordsprayingoutlookwebaccess-howtogainaccesstodoma... | Password Spraying Outlook Web Access - How to Gain Access to Domain Credentials Without Being on a Target's Network: Part 2 |
/blog/exploitingpasswordreuseonpersonalaccounts-howtogainacc... | Exploiting Password Reuse on Personal Accounts - How to Gain Access to Domain Credentials Without Being on a Target's Network: P... |
/blog/storedxssviareflectedxssorhownottofixyourwebapplicatio... | Stored XSS via Reflected XSS... or How Not to Fix Your Web Application |
/blog/sansholidaychallenge2015write-up | SANS Holiday Challenge 2015 Write-up |
/blog/pentestapocalypsetalk | Pentest Apocalypse Talk |
/blog/derbycon2014 | Derbycon 2014 |
/blog/securitybsidesorlandosans2014 | Security BSides Orlando & SANS 2014 |
/blog/dafthackhackingchallenge1 | DAFTHACK Hacking Challenge #1 |
/blog/targetabreakdownofwhathappened | Target: A Breakdown of What Happened |
/blog/hownottosellawirelessrouteronebay | How Not to Sell a Wireless Router on Ebay |
/sans-holiday-challenge-2012-write-up | SANS Holiday Challenge 2012 Write-up |
/blog/pentestingwithbacktrackoscpreview | Pentesting with Backtrack/OSCP Review |
/blog/poisonportsv10released | Poisonports v1.0 Released |
/blog/05302012-flamemalware | Flame Malware |
/blog/daftreview-wifipineapplemarkiv | DAFTREVIEW - WiFi Pineapple Mark IV |
/blog/04212012-howtobecomeahacker | How to Become A Hacker |
/how-to | how-to |
/hotspot-password-cracking | Hotspot Password Cracking |
/host-based-dynamic-firewalls | Host Based Dynamic Firewalls |
/become-a-hacker | Become a Hacker |
/gather-public-information | Gather Public Information |
/vmplayer-virtual-network-editor | VMPlayer Virtual Network Editor |
/hack-a-drummer | Hacking A Drummer |
/basic-exploit-mod-part-1 | Basic Exploit Modification part 1: Porting to a Different OS Version |
/basic-exploit-mod-part-2 | Basic Exploit Modification part 2: Changing Shellcode |
/blog/howtospearphishyouremployeespart1thesetup | How to Spear Phish Your Employees: Part 1, The Setup |
/blog/howtospearphishyouremployeespart2testingfunctionality | How to Spear Phish Your Employees: Part 2, Testing Functionality |
/blog/howtospearphishyouremployeespart3hooklineandsinker | How to Spear Phish Your Employees: Part 3, Hook, Line, and Sinker |
/blog/howtocrackpasswordhashesefficiently | How to Crack Password Hashes Efficiently |
/projects | projects |
/blog/04202012-honeyspotv10 | Honeyspot v1.0 |
/lockpick-village | Lockpicking Practice Station |
/videos | videos |
/webcasts-and-conference-presentations | Webcasts and Conference Presentations |
/tradecraft-security-weekly | Tradecraft Security Weekly |
/hack-naked-tv | Hack Naked TV |
/links2 | links |
/about | about |
/blog/attackingexchangewithmailsniper | Attacking Exchange With MailSniper |
Domain Name: DAFTHACK.COM
Registry Domain ID: 1708973976_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.enom.com
Registrar URL: http://www.enom.com
Updated Date: 2018-03-19T01:59:39Z
Creation Date: 2012-03-26T02:14:00Z
Registry Expiry Date: 2019-03-26T02:14:00Z
Registrar: eNom, Inc.
Registrar IANA ID: 48
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: DNS1.NAME-SERVICES.COM
Name Server: DNS2.NAME-SERVICES.COM
Name Server: DNS3.NAME-SERVICES.COM
Name Server: DNS4.NAME-SERVICES.COM
Name Server: DNS5.NAME-SERVICES.COM
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2018-11-20T03:56:06Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar. Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.
TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.
The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.
США - Сиэтл - 50.22.174.248
SoftLayer Technologies
SoftLayer Technologies
HTTP/1.1 200 OK
Content-Type: text/html; charset=utf-8
X-Frame-Options: SAMEORIGIN
X-Robots-Tag: noarchive
Last-Modified: Wed, 21 Aug 2019 20:13:41 GMT
Expires: Sun, 01 Sep 2019 10:56:24 GMT
Date: Sun, 01 Sep 2019 10:56:24 GMT
Cache-Control: private, max-age=5
X-Content-Type-Options: nosniff
X-XSS-Protection: 1; mode=block
Server: GSE
Accept-Ranges: none
Vary: Accept-Encoding
Transfer-Encoding: chunked
Кнопка для анализа сайта в один клик, для установки перетащите ссылку на "Панель закладок"