Возраст домена | 14 лет |
Дата окончания | Истек срок регистрации |
PR | 5 |
ИКС | |
Страниц в Google | 50 |
Страниц в Яндексе | 4 |
Dmoz | Нет |
Яндекс Каталог | Нет |
Alexa Traffic Rank | 12562739 |
Alexa Country | Нет данных |
История изменения показателей | Авторизация |
Идет сбор информации... Обновить
Data Differential, solutions solved by Drizzle, Memcached, GearmanD
n/a
n/a
UTF-8
27.75 КБ
286
2 209 симв.
1 851 симв.
Данные предоставлены сервисом semrush
Данные linkpad ( 23 Апреля 2015 ) | |
Количество ссылок на сайт | 17 |
Количество доменов, которые ссылаются на сайт | 7 |
Количество найденных анкоров | 3 |
Исходящие (внешние) ссылки домена | 151 |
Количество доменов, на которые ссылается сайт | 40 |
Количество исходящих анкоров | 32 |
Внешние ссылки главной страницы ( 5 ) | |
libmemcached.org/ nofollow | libMemcached |
gearman.org/ nofollow | Gearman |
accounts.google.com/ServiceLogin?continue=sites.google.com/a... | Sign in |
sites.google.com/a/datadifferential.com/welcome/system/app/p... | Report Abuse |
sites.google.com/site | Google Sites |
Внутренние ссылки главной страницы ( 37 ) | |
/home | Data Differential |
/solutions | Solutions |
/news-and-events | News |
/events | Events |
/learnmore | Learn More |
/about | About |
/about/white-papers | White Papers |
/datadifferential-html | DataDifferential |
/documentation | documentation |
/events/brianakerspeakingatopensourcebridgejune21-24 | Brian Aker speaking at Open Source Bridge June 21-24 |
/events/brianakerctoofdatadifferentialtalksatmysqlconference | Brian Aker, CTO of Data Differential Talks at MySQL Conference |
/events/drizzleanddrizzlerelatedtalksatthemysqlconferenceapr... | Drizzle and Drizzle Related Talks at the MySQL Conference April 11-14 |
/events/drizzletalksandeventsatoscon2011 | Drizzle talks and events at OSCON 2011 |
/events/gearmantalkandabirdsofafeathersessionatoscon | Gearman Talk and a Birds of A Feather Session at OSCON |
/events/keynotebybrianaketdatadifferentialctoatoscon2011 | Keynote by Brian Aker, Data Differential CTO at OSCON 2011 |
/events/may262011drizzleatperconalive | May 26, 2011 Drizzle at Percona Live |
/events/osconbofsessionsfordrizzle | OSCon BoF session for Drizzle |
/events/osconbofsessionforthegearmancommunity | OSCon BoF Session for the Gearman Community |
/events/osconcallforpapersendsjanuary12 | OSCON call for papers ends January 12! |
/events/patrickgalbraithtospeakatperconalive | Patrick Galbraith to speak at Percona Live |
/events/stewartsmithspeakingatosdc2011ondrizzle | Stewart Smith Speaking at OSDC 2011 on Drizzle |
/events/stewartsmithspeakingmay26atperconalive | Stewart Smith Speaking May 26 at Percona Live |
/events/stewartsmithtospeakatlinuxconfau2012 | Stewart Smith to speak at LinuxConfAU 2012. |
/events/stewartsmithcoredrizzledeveloperspeakingatoscon2011 | Stewart Smith, core Drizzle Developer, speaking at OSCon 2011 |
/events/upcomingtalksbybrianakerctoofdatadifferential | Upcoming Talks by Brian Aker, CTO of Data Differential |
/learnmore/basic-replication-in-drizzle | Basic Replication in Drizzle |
/news-and-events/_draft_post | Drizzle Developer Day on April 15, 2011 after the MySQL Conference. |
/news-and-events/drizzlefreemontbetareleased | Drizzle Freemont Beta Released |
/news-and-events/drizzlesimplereplicationwalkthrough | Drizzle Simple Replication Walkthrough |
/news-and-events/data-differential-on-twitter | Drizzle, MemcacheD and GearmanD on Twitter |
/news-and-events/fremontbeta220111129hasbeenreleased | Fremont beta2 (2011.11.29) has been released |
/news-and-events/gearman23hasbeenreleased | Gearman .23 has been released. |
/news-and-events/gearman025hasbeenreleased | Gearman 0.25 has been released! |
/news-and-events/memcachednewfeatures | Memcached new features... |
/news-and-events/oreillyradarpostwithbrianakeraboutusingmemc... | O'Reilly Radar post with Brian Aker about using Memcached |
/system/app/pages/sitemap/hierarchy | Sitemap |
/system/app/pages/recentChanges | Recent Site Activity |
Domain Name: datadifferential.com
Registry Domain ID: 1591014950_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.gandi.net
Registrar URL: http://www.gandi.net
Updated Date: 2015-04-01T21:32:34Z
Creation Date: 2010-03-31T20:28:09Z
Registrar Registration Expiration Date: 2016-03-31T20:28:09Z
Registrar: GANDI SAS
Registrar IANA ID: 81
Registrar Abuse Contact Email: abuse@support.gandi.net
Registrar Abuse Contact Phone: +33.170377661
Reseller:
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status:
Domain Status:
Domain Status:
Domain Status:
Registry Registrant ID:
Registrant Name: Brian Aker
Registrant Organization:
Registrant Street: Obfuscated whois Gandi-63-65 boulevard Massena
Registrant City: Obfuscated whois Gandi-Paris
Registrant State/Province:
Registrant Postal Code: 75013
Registrant Country: FR
Registrant Phone: +33.170377666
Registrant Phone Ext:
Registrant Fax: +33.143730576
Registrant Fax Ext:
Registrant Email: ae34ddf116f36b71309f58396fe2a5bf-3337180@contact.gandi.net
Registry Admin ID:
Admin Name: Brian Aker
Admin Organization:
Admin Street: Obfuscated whois Gandi-63-65 boulevard Massena
Admin City: Obfuscated whois Gandi-Paris
Admin State/Province:
Admin Postal Code: 75013
Admin Country: FR
Admin Phone: +33.170377666
Admin Phone Ext:
Admin Fax: +33.143730576
Admin Fax Ext:
Admin Email: 3b92f43e341141ff05a54be2f94964d0-2091370@contact.gandi.net
Registry Tech ID:
Tech Name: Brian Aker
Tech Organization:
Tech Street: Obfuscated whois Gandi-63-65 boulevard Massena
Tech City: Obfuscated whois Gandi-Paris
Tech State/Province:
Tech Postal Code: 75013
Tech Country: FR
Tech Phone: +33.170377666
Tech Phone Ext:
Tech Fax: +33.143730576
Tech Fax Ext:
Tech Email: 3b92f43e341141ff05a54be2f94964d0-2091370@contact.gandi.net
Name Server: A.DNS.GANDI.NET
Name Server: B.DNS.GANDI.NET
Name Server: C.DNS.GANDI.NET
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
>>> Last update of WHOIS database: 2015-11-20T20:18:51Z <<<
For more information on Whois status codes, please visit
https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en
Reseller Email:
Reseller URL:
Personal data access and use are governed by French law, any use for the purpose of unsolicited mass commercial advertising as well as any mass or automated inquiries (for any intent other than the registration or modification of a domain name) are strictly forbidden. Copy of whole or part of our database without Gandi's endorsement is strictly forbidden. <br />
A dispute over the ownership of a domain name may be subject to the alternate procedure established by the Registry in question or brought before the courts. <br />
For additional information, please contact us via the following form:<br />
https://www.gandi.net/support/contacter/mail/
HTTP/1.1 200 OK
Content-Type: text/html; charset=utf-8
X-Frame-Options: SAMEORIGIN
X-Robots-Tag: noarchive
Last-Modified: Thu, 01 Nov 2018 07:39:04 GMT
Expires: Tue, 13 Nov 2018 07:22:01 GMT
Date: Tue, 13 Nov 2018 07:22:01 GMT
Cache-Control: private, max-age=5
X-Content-Type-Options: nosniff
X-XSS-Protection: 1; mode=block
Server: GSE
Accept-Ranges: none
Vary: Accept-Encoding
Transfer-Encoding: chunked
Кнопка для анализа сайта в один клик, для установки перетащите ссылку на "Панель закладок"