Возраст домена | 14 лет |
Дата окончания | Истек срок регистрации |
PR | 3 |
ИКС | n/a |
Страниц в Google | 70 |
Страниц в Яндексе | 0 |
Dmoz | Нет |
Яндекс Каталог | Нет |
Alexa Traffic Rank | 16466671 |
Alexa Country | Нет данных |
История изменения показателей | Авторизация |
Идет сбор информации... Обновить
Deep Creek Lake Family Adventure Activities and Eco Tours - Kayaking Tours - Maryland Guided Hiking Trips - Team Building- Deep Creek Lake Activities for Kids
n/a
Family Deep Creek Lake Adventures, Deep Creek lake Family Activities, Kayaking, Hiking, Team Building and Environmental Learning Programs. Family Activity Information.
ISO-8859-1
35.45 КБ
1 001
6 947 симв.
5 789 симв.
Данные предоставлены сервисом semrush
Сайт | Общие фразы | PR | тИЦ | Alexa Rank | Alexa Country | |
---|---|---|---|---|---|---|
![]() |
21 | 3 |
0 | 957856 | ![]() | |
![]() |
13 | 3 |
0 | 824990 | ![]() | |
![]() ![]() |
10 | 6 |
0 | 2279 | ![]() | |
![]() ![]() |
10 | 4 |
0 | 2435090 | ![]() | |
![]() ![]() |
9 | 6 |
0 | 6471 | ![]() | |
![]() |
7 | 6 |
0 | 158835 | ![]() | |
![]() ![]() |
7 | 7 |
0 | 21155 | ![]() | |
![]() ![]() |
6 | 7 |
0 | 264 | ![]() | |
![]() ![]() |
6 | 3 |
0 | 2268049 | ![]() |
|
![]() ![]() |
6 | 7 |
0 | 7787 | ![]() | |
Еще 40 сайтов после авторизации |
Данные предоставлены сервисом semrush
Данные linkpad ( 25 Августа 2013 ) | |
Количество ссылок на сайт | 11 |
Количество доменов, которые ссылаются на сайт | 7 |
Количество найденных анкоров | 6 |
Исходящие (внешние) ссылки домена | 44 |
Количество доменов, на которые ссылается сайт | 23 |
Количество исходящих анкоров | 22 |
Внешние ссылки главной страницы ( 15 ) | |
dhtml-menu-builder.com | Javascript DHTML Drop Down Menu Powered by dhtml-menu-builder.com |
backbonefarm.com/daycamp | - |
tripadvisor.com/Attraction_Review-g41149-d3443057-Reviews-Al... | TRIP ADVISOR |
tripadvisor.com/Attraction_Review-g41149-d3443057-Reviews-Al... | <img> |
allearthtours.com/private_yoga.html | Private Yoga Instructor |
yelp.com/biz/all-earth-eco-tours-friendsville | YOGA YELP REVIEW |
facebook.com/groups/366750204090 | <img> |
youtu.be/xvBEVWTyAcE | Watch Our SNOWSHOEING VIDEO |
google.com/search?rlz=1C1PRFB_enUS470US511&ei=PvhjXbSMGOrU5g... | GOOGLE REVIEWS |
video.mpt.tv/video/1535870943 | Outdoors Maryland |
kitzmillermd.org | TOWN OF KITZMILLER MARYLAND |
friendsville.org | Friendsville Maryland Website |
allearthecotours.com/maryland_cross_country_ski.html | Deep Creek Lake Cross Country Skiing Lessons |
extremetracking.com/open?login=vman22 | <img> |
deepcreeklakewedding.com | site by Deep Creek Lake Wedding |
Внутренние ссылки главной страницы ( 16 ) | |
private_yoga.html | <img> |
deepcreeklakefamilyactivities.com/kayaking_trip_format_detai... | INFORMATION HERE |
maryland_kayaking_tours.html | Savage Rez Kayaking Tours |
kayak_tour_testimonials.html | Hear what Guests have to say.... |
deepcreeklakefamilyactivities.com/teambuilding/team_building... | Team Survivor Group Program |
deep_creek_lake_lodging.html | Deep Creek Lake Lodging and Rental Homes |
adventure_gift_certificate.html | now availble for online purchase |
snowshoe_cookie_tromp.html | 9AM TO 11AM |
swallow_falls_tour.html | Two Hour Swallow Falls Nature Tour |
river_walk.htm | 3 hour River Walks |
family_farm_tour.html | Family Organic Farm Tours |
contact_all_earth.html | EMAIL ALL EARTH EOC TOURS |
maryland_snowshoeing.html | Deep Creek Lake Maryland Snowshoeing Tours |
deepcreeklakefamilyactivities.com/NEWkayak_photos.html | Deep Creek Lake Maryland Kayaking Tours |
deepcreeklakefamilyactivities.com/kayaking.html | Eco Flatwater Kayaking |
deepcreeklakefamilyactivities.com/kay_format.htm | Calm Water Kayaking |
Domain Name: DEEPCREEKLAKEFAMILYACTIVITIES.COM
Registry Domain ID: 1579102144_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2017-12-16T15:56:31Z
Creation Date: 2009-12-16T16:53:54Z
Registry Expiry Date: 2018-12-16T16:53:54Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS1.BLUEHOST.COM
Name Server: NS2.BLUEHOST.COM
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2018-10-10T12:56:57Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar. Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.
TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.
The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.
США - 207.241.148.80
About
About
HTTP/1.1 200 OK
Date: Mon, 23 Dec 2019 08:09:11 GMT
Server: nginx/1.17.6
Content-Type: text/html
Content-Length: 36297
Last-Modified: Sat, 07 Dec 2019 00:23:18 GMT
Vary: Accept-Encoding
X-Server-Cache: true
X-Proxy-Cache: EXPIRED
Accept-Ranges: bytes
Кнопка для анализа сайта в один клик, для установки перетащите ссылку на "Панель закладок"