Возраст домена | 13 лет |
Дата окончания | Истек срок регистрации |
PR | 1 |
ИКС | |
Страниц в Google | 1 |
Страниц в Яндексе | 0 |
Dmoz | Нет |
Яндекс Каталог | Нет |
Alexa Traffic Rank | 11336528 |
Alexa Country | Нет данных |
История изменения показателей | Авторизация |
Идет сбор информации... Обновить
Dinghy davits and inflatable boat davit systems for inflatables and dinghy davits for inflatable boats and dinghies .
dinghy davits for inflatables, dinghy davits, inflatable boat davits, dinghy davit, davits for inflatables, boat davit system, boat davits, inflatable dinghy davits, inflatable boats davit
Dinghy davit and inflatable boat davit systems for inflatable boats and dinghies to davit the dinghy on a yacht or sailboat.
UTF-8
19.4 КБ
561
3 954 симв.
3 332 симв.
Идет сбор информации... Обновить
Идет сбор информации... Обновить
Счетчик | Посетители за 24 часа | Просмотры | Просмотров на посетителя |
---|---|---|---|
![]() | Нет доступа | Нет доступа | n/a |
Данные linkpad ( 10 Февраля 2014 ) | |
Количество ссылок на сайт | 24 |
Количество доменов, которые ссылаются на сайт | 5 |
Количество найденных анкоров | 2 |
Исходящие (внешние) ссылки домена | 16 |
Количество доменов, на которые ссылается сайт | 16 |
Количество исходящих анкоров | 11 |
Внешние ссылки главной страницы ( 10 ) | |
twitter.com/allboatproducts | <img> |
facebook.com/allboatproducts | <img> |
youtube.com/user/boatingfun1 | - |
inflatableboatdavits.com | www.inflatableboatdavits.com |
allboatproducts.com | www.allboatproducts.com |
allinflatables.com/ | www.allinflatables.com |
inflatableboatpaint.com/ | www.inflatableboatpaint.com |
allboatinfo.com | www.allboatinfo.com |
inflatable-boats-kayaks-accessories.com/ | www.inflatable-boats-kayaks-accessories.com |
inflatableboats.ca/ | www.inflatableboats.ca |
Внутренние ссылки главной страницы ( 13 ) | |
dinghydavitsystems.com | www.dinghydavitsystems.com |
davitselection.html | comparison chart here |
davitphotos.html | Photo Gallery |
dinghydavitsystems.html | See all our Davit Products now. |
contactus.html | Expert Advice |
dinghyrepairproducts.html | Repair Products |
index.html | Home |
winchondinghydavitsystems.html | View winch-on davits here |
pullondinghydavitsystems.html | View pull-on davits here |
slingdinghydavitsystems.html | View sling davits here |
pivotupdinghydavitsystems.html | View pivot-up davits here |
quicksnapdinghydavitsystems.html | View quick-snap davits here |
liftupdinghydavitsystems.html | View lift-up davits here |
Domain Name: DINGHYDAVITSYSTEMS.COM
Registry Domain ID: 1627181479_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.names4ever.com
Registrar URL: http://www.aplus.net
Updated Date: 2017-11-24T06:01:45Z
Creation Date: 2010-11-24T23:40:05Z
Registry Expiry Date: 2018-11-24T23:40:05Z
Registrar: Deluxe Small Business Sales, Inc. d/b/a Aplus.net
Registrar IANA ID: 52
Registrar Abuse Contact Email: dns@cs.aplus.net
Registrar Abuse Contact Phone: 855.791.8966
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.APLUS.NET
Name Server: NS2.APLUS.NET
Name Server: NS3.APLUS.NET
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2018-10-18T23:17:42Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar. Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.
TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.
The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.
Канада - 64.29.151.221
InternetNamesForBusiness.com
InternetNamesForBusiness.com
HTTP/1.1 200 OK
Date: Thu, 09 Jan 2020 17:43:12 GMT
Content-Type: text/html
Content-Length: 19869
Connection: keep-alive
Vary: X-Forwarded-Host
Last-Modified: Thu, 24 Mar 2016 00:56:52 GMT
Set-Cookie: TS0194eee0=010bd780441eefe0e313853344f75521061727922226e462cbc197ec2f784aecf302b9abd58211d1875982a6bcbe4b068fecc36d42; Path=/
Кнопка для анализа сайта в один клик, для установки перетащите ссылку на "Панель закладок"