Возраст домена | 20 лет |
Дата окончания | Истек срок регистрации |
PR | 1 |
ИКС | |
Страниц в Google | 120 |
Страниц в Яндексе | 76 |
Dmoz | Нет |
Яндекс Каталог | Нет |
Alexa Traffic Rank | 19861379 |
Alexa Country | Нет данных |
История изменения показателей | Авторизация |
Идет сбор информации... Обновить
Engraved Crystal Awards - Glass & Crystal Products
art glass, glass crystal Krystoff, Krystof trophies trophy awards award plaques plaque recognition medals medal soccer ribbons ribbon engraving engraved engrave gifts gift new hampshire laconia concord vermont maine nh vt me ma mass massachusetts new england gavels gavel ceremonial memorial perpetual custom signs promotional products engraver engravings engravers plastic wood acrylics corporate personalize personalized personalizing advertising specialties certificates cast bronze nameplates nam
We design and produce customized engraved glass, crystal, awards, trophies, plaques, ribbons, gifts, medals, signage, promotional products and special recognition items.
UTF-8
33.6 КБ
578
4 232 симв.
3 598 симв.
Данные предоставлены сервисом semrush
Сайт | Общие фразы | PR | тИЦ | Alexa Rank | Alexa Country | |
---|---|---|---|---|---|---|
crystalimagesinc.com | 6 | 1 |
0 | 3287043 | Нет данных | |
recognitionsource.com | 4 | 2 |
0 | 1849112 | Нет данных | |
personalized-engraved-gifts.com | 3 | 5 |
0 | 4786387 | Нет данных | |
personalizationmall.com | 3 | 5 |
0 | 37565 | 5152 | |
epicengraving.com | 3 | 2 |
0 | 19198164 | Нет данных | |
edco.com | 3 | 3 |
0 | 531403 | 125872 | |
crystalartusa.com | 3 | 2 |
0 | 6455270 | Нет данных | |
plaquemaker.com | 3 | 2 |
0 | 467970 | 119319 | |
diyawards.com | 2 | 5 |
0 | 591085 | 305696 | |
awards-more.com | 2 | 1 |
0 | 14093738 | Нет данных | |
Еще 40 сайтов после авторизации |
Данные предоставлены сервисом semrush
Счетчик | Посетители за 24 часа | Просмотры | Просмотров на посетителя |
---|---|---|---|
StatCounter | Нет доступа | Нет доступа | n/a |
Данные linkpad ( 6 Марта 2013 ) | |
Количество ссылок на сайт | 253 |
Количество доменов, которые ссылаются на сайт | 22 |
Количество найденных анкоров | 3 |
Исходящие (внешние) ссылки домена | 122 |
Количество доменов, на которые ссылается сайт | 38 |
Количество исходящих анкоров | 3 |
Внешние ссылки главной страницы ( 3 ) | |
eag.espwebsite.com/ | See Our Promotional Products Selection! |
EngravingAwardsGifts.com | www.EngravingAwardsGifts.com |
statcounter.com | <img> |
Внутренние ссылки главной страницы ( 89 ) | |
howtoorder.html | an Order |
engravedcrystalawardsshipping.html | Information |
aboutcrystal.html | Facts |
engravedcrystalawardstestimonials.html | Testimonials |
graphicdesignengravedcrystalawards.html | Design |
engravedcrystalawardsmember.html | Affiliations |
crystaleggartglassawards.html | Art Glass Eggs |
crystalhandblownartglassawards.html | Hand Blown Art Glass |
crystaldesignerartglassawards.html | Designer Art Glass Awards |
crystalartglassanimalawards.html | Hand Blown Art Glass Animals |
crystaleliteartglassawards.html | Elite Art Glass Awards |
crystalspheresglobesartglassawards.html | Globes & Spheres |
crystaldesignertrophycups.html | Crystal Designer Trophies |
crystalhandblownartglassawards2.html | Hand Blown Art Glass |
crystaltowersobelisksartglassawards.html | Crystal Towers & Obelisks |
crystalvasesbowlscompotesartglassawards.html | Vases & Compotes |
oxfordartglassawards.html | Oxford Art Glass Awards |
standingartglassgeometricawards.html | Geometric Awards |
standingartglassdiscawards.html | Art Glass Awards |
fractalawards.html | Art Glass Awards |
3dlasercrystalcustomblockawards.html | 3-D Custom Block |
3dlasercrystalglobeawards.html | 3-D Globe Awards |
plaques.html | Crystal Plaques |
standupawards.html | Crystal Stand Up Awards |
curvedglass.html | Curved Glass Awards |
emeraldglass.html | Emerald Glass Awards |
obeliskstowersglassawards.html | Crystal Obelisks & Towers |
diamond.html | Crystal Diamond Awards |
starawards.html | Crystal Star Awards |
bowls.html | Crystal Bowls |
trophycups.html | Crystal Trophy Cups |
vases.html | Crystal Vases |
cobaltcrystal.html | Cobalt Crystal |
standupawardsblueopticalcrystal.html | Crystal Awards |
baseball.html | Baseball Awards |
basketball.html | Basketball Awards |
bowling.html | Bowling Awards |
boxing.html | Boxing Awards |
football.html | Football Awards |
golf.html | Golf Awards |
crystalsailingawards.html | Sailing Awards |
soccer.html | Soccer Awards |
tennis.html | Tennis Awards |
crystalartglassawards.html | Art Glass Awards |
flags.html | Crystal Flag Awards |
inukshukawards.html | Inukshuk Awards & Gifts |
globes.html | Crystal Globes |
storybookcrystal.html | Storybook Crystal |
eagles.html | All Crystal Eagles |
leadcrystalanimalawards.html | Lead Crystal Animals |
leadcrystaleagleawards.html | Lead Crystal Eagles |
castmetalartglassawards.html | Art Glass Cast Metal Awards |
crystalsportsawards.html | Crystal Sports Awards |
2dcrystaltransportationawards.html | 2-D Transportation Awards |
3dcrystaltransportationawards.html | 3-D Transportation Awards |
2dstockdesignawards.html | 2-D Stock Design Awards |
2dcustomdesignawards.html | 2-D Awards: Custom |
3dcustomdesignawards.html | Custom 3-D Awards |
2dcrystalgamingawards.html | Crystal Gaming Awards |
2dcrystaloildrillingthemeawards.html | Crystal Oil Drilling Awards |
apples.html | Crystal Apples |
books.html | Crystal Books |
boxes.html | Crystal Boxes |
clocks.html | Crystal Clocks |
desksetitems.html | Crystal Desk Set Items |
hearts.html | Crystal Hearts |
paperweights.html | Crystal Paperweights |
pictureframes.html | Crystal Picture Frames |
crystalmugsandtankards.html | Crystal Mugs & Tankards |
decanters.html | Crystal Decanters |
icebuckets.html | Crystal Ice Buckets |
glasswaresets.html | Glassware Sets |
hurricanelamps.html | Crystal Candle Holders |
stemware.html | Stemware |
bottlestoppers.html | Bottle Stoppers |
pitchers.html | Crystal Pitchers |
platesandplatters.html | Crystal Plates & Platters |
carafes.html | Crystal Carafes |
glassware.html | Glassware |
canisters.html | Coasters |
coasters.html | <img> |
ornaments.html | Crystal Ornaments |
ornaments-fullcolor.html | Full Color Ornaments |
ceramicmugsandtankards.html | Ceramic Mugs |
marble.html | Marble Products |
silvertraysbowls.html | Silver Plates & Trays |
executivegifts.html | Executive Gifts |
noncrystaleagles.html | Non-Crystal & Cast Eagles |
woodgifts.html | Wood Gifts |
Domain Name: ENGRAVEDCRYSTALAWARDS.COM
Registry Domain ID: 109611723_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2018-01-10T19:06:04Z
Creation Date: 2004-01-09T17:56:20Z
Registry Expiry Date: 2019-01-09T17:56:20Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: PDNS07.DOMAINCONTROL.COM
Name Server: PDNS08.DOMAINCONTROL.COM
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2018-10-06T17:07:08Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar. Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.
TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.
The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.
США - 198.106.5.105
Verio Web Hosting
Verio Web Hosting - Sterling
HTTP/1.1 200 OK
Date: Tue, 30 Apr 2019 03:31:26 GMT
Server: Apache
Last-Modified: Mon, 28 May 2018 14:00:45 GMT
Accept-Ranges: bytes
Content-Length: 34407
Connection: close
Content-Type: text/html
Кнопка для анализа сайта в один клик, для установки перетащите ссылку на "Панель закладок"