Возраст домена | 13 лет |
Дата окончания | Истек срок регистрации |
ИКС | |
Страниц в Google | 7 |
Страниц в Яндексе | 3 |
Dmoz | Нет |
Яндекс Каталог | Нет |
Alexa Traffic Rank | Нет данных |
Alexa Country | Нет данных |
История изменения показателей | Авторизация |
Идет сбор информации... Обновить
Fort Langley Village Farmers' Market
n/a
Fort Langley Village Farmers' Market, fresh vegetables & fruit, flowers, baking, honey, jams, wines & craft beers. B.C. Arts & Crafts, soaps & jewelry, clothing, painters & woodcrafters.
UTF-8
138.29 КБ
859
6 339 симв.
5 318 симв.
Идет сбор информации... Обновить
Идет сбор информации... Обновить
Domain Name: FORTLANGLEYVILLAGEFARMERSMARKET.ORG
Registry Domain ID: D161774548-LROR
Registrar WHOIS Server: whois.domain.com
Registrar URL: www.domain.com
Updated Date: 2017-02-27T15:15:21Z
Creation Date: 2011-03-15T16:36:37Z
Registry Expiry Date: 2018-03-15T16:36:37Z
Registrar Registration Expiration Date:
Registrar: Domain.com, LLC
Registrar IANA ID: 886
Registrar Abuse Contact Email: compliance@domain-inc.net
Registrar Abuse Contact Phone: +1.6022262389
Reseller:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registry Registrant ID: C185531920-LROR
Registrant Name: Malcolm Weatherston
Registrant Organization: AgriMarkets
Registrant Street: P.O. Box 1603
Registrant City: Fort Langley
Registrant State/Province: BC
Registrant Postal Code: V1M 0E8
Registrant Country: CA
Registrant Phone: +1.6047282080
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: malcolmaw@shaw.ca
Registry Admin ID: C185531921-LROR
Admin Name: Malcolm Weatherston
Admin Organization: AgriMarkets
Admin Street: P.O. Box 1603
Admin City: Fort Langley
Admin State/Province: BC
Admin Postal Code: V1M 0E8
Admin Country: CA
Admin Phone: +1.6047282080
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: malcolmaw@shaw.ca
Registry Tech ID: C185531923-LROR
Tech Name: Malcolm Weatherston
Tech Organization: AgriMarkets
Tech Street: P.O. Box 1603
Tech City: Fort Langley
Tech State/Province: BC
Tech Postal Code: V1M 0E8
Tech Country: CA
Tech Phone: +1.6047282080
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: malcolmaw@shaw.ca
Name Server: NS1.HOSTUTOPIA.CA
Name Server: NS2.HOSTUTOPIA.CA
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2017-11-28T17:23:11Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
Access to Public Interest Registry WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the Public Interest Registry registry database. The data in this record is provided by Public Interest Registry for informational purposes only, and Public Interest Registry does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to: (a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Afilias except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. Public Interest Registry reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy.
sitemap: http://cdn.attracta.com/sitemap/785995.xml.gz
Канада - Монреаль - 108.163.188.154
iWeb Technologies
iWeb Technologies
HTTP/1.1 200 OK
Date: Wed, 13 Feb 2019 17:11:59 GMT
Server: Apache
Last-Modified: Wed, 13 Feb 2019 03:46:15 GMT
Accept-Ranges: bytes
Content-Length: 141612
Vary: Accept-Encoding,User-Agent
Content-Type: text/html; charset=UTF-8
Кнопка для анализа сайта в один клик, для установки перетащите ссылку на "Панель закладок"