Возраст домена | n/a |
Дата окончания | n/a |
PR | 3 |
ИКС | |
Страниц в Google | 129 |
Страниц в Яндексе | 1 |
Dmoz | Нет |
Яндекс Каталог | Нет |
Alexa Traffic Rank | Нет данных |
Alexa Country | Нет данных |
История изменения показателей | Авторизация |
Идет сбор информации... Обновить
HOME - Friemann & Wolf Batterietechnik GmbH
n/a
n/a
UTF-8
115.69 КБ
679
6 027 симв.
5 193 симв.
Данные предоставлены сервисом semrush
Сайт | Общие фразы | PR | тИЦ | Alexa Rank | Alexa Country | |
---|---|---|---|---|---|---|
![]() ![]() |
5 | 9 |
0 | 5 | ![]() | |
![]() ![]() |
5 | 4 |
10 | 1424075 | ![]() | |
![]() |
5 | 1 |
0 | 6659099 | ![]() |
|
![]() |
4 | 4 |
0 | 8555345 | ![]() |
|
![]() ![]() |
4 | 6 |
0 | 129897 | ![]() | |
![]() ![]() |
4 | 6 |
0 | 255513 | ![]() | |
![]() ![]() |
3 | 5 |
30 | 961817 | ![]() | |
![]() ![]() |
3 | 4 |
0 | 22500751 | ![]() |
|
![]() ![]() |
3 | 8 |
0 | 2287 | ![]() | |
![]() ![]() |
3 | 5 |
0 | 578124 | ![]() |
|
Еще 40 сайтов после авторизации |
Данные предоставлены сервисом semrush
Данные linkpad ( 23 Июня 2014 ) | |
Количество ссылок на сайт | 9 |
Количество доменов, которые ссылаются на сайт | 9 |
Количество найденных анкоров | 6 |
Исходящие (внешние) ссылки домена | 0 |
Количество доменов, на которые ссылается сайт | 0 |
Количество исходящих анкоров | 0 |
Внешние ссылки главной страницы ( 30 ) | |
friemann-wolf.de/privacy-police-datenschutzerklaerung/ | Privacy Police / Datenschutzerklärung |
friemann-wolf.de/datenschutzerklaerung-3/ | DATENSCHUTZERKLÄRUNG |
friemann-wolf.de/imprint/ | IMPRINT |
friemann-wolf.de/ | HOME |
friemann-wolf.de/category/allgemein/ | ALLE NEWS ANZEIGEN |
friemann-wolf.de/company/ | MORE ABOUT FRIEMANN & WOLF |
friemann-wolf.de/certificates-quality/ | Certificates & Quality |
friemann-wolf.de/products/ | PRODUCTS |
friemann-wolf.de/li-mno2-batteries/ | MORE INFORMATION |
friemann-wolf.de/cell-technology/ | MORE INFORMATION |
friemann-wolf.de/performance/ | MORE INFORMATION |
friemann-wolf.de/specific-properties/ | - |
friemann-wolf.de/overview/ | OVERVIEW OF FRIEMANN & WOLF LITHIUM BATTERY RANGE |
friemann-wolf.de/atex-iecex-certified-cells/ | MORE INFORMATION |
friemann-wolf.de/cells/ | MORE INFORMATION |
friemann-wolf.de/batteries/ | MORE INFORMATION |
friemann-wolf.de/handling-transport/ | - |
friemann-wolf.de/downloads/ | DOWNLOADCENTER |
friemann-wolf.de/contact/ | If you have any questions please contact us |
friemann-wolf.de/friemann-wolf-batterietechnik-gmbh-batterie... | Friemann & Wolf Batterietechnik GmbH – Batteriekompetenz aus Hessen11. Februar 2015 - 14:42 |
friemann-wolf.de/friemann-wolf-batterietechnik-gmbh-saft-rei... | Friemann & Wolf Batterietechnik GmbH / Saft reinforce their leadership in advanced primary lithium cells4. November 2014 - 14:40 |
friemann-wolf.de/oeffentlichkeitskampagne-energievollerleben... | Öffentlichkeitskampagne „energievollerleben“ des ZVEI und der deutschen Batterieindustrie10. November 2013 - 14:38 |
friemann-wolf.de/new-friemann-wolf-m52ex-intrinsically-safe-... | New Friemann & Wolf M52EX intrinsically safe C-size cell for potentially explosive atmospheres |
friemann-wolf.de/new-friemann-wolf-d-cell-m20ex-for-potentia... | New Friemann & Wolf D-cell M20EX for potentially explosive applications |
friemann-wolf.de/friemann-wolf-limno2-batteries-powers-data-... | Friemann & Wolf LiMnO2 batteries powers data logging system on stratosphere balloon |
friemann-wolf.de/all-friemann-wolf-limno2-batteries-are-now-... | All Friemann & Wolf LiMnO2 batteries are now also available in antimagnetic versions |
friemann-wolf.de/friemann-wolf-expands-its-range-of-primary-... | Friemann & Wolf expands its range of primary batteries with new, performance-optimised LiMnO2 D-cell, M20 |
friemann-wolf.de/wp-content/uploads/2018/09/Friemann_Wolf_Ce... | <img> |
friemann-wolf.de/wp-content/uploads/2018/09/QS-Zertifikat-BV... | <img> |
friemann-wolf.de/wp-content/uploads/2018/09/UL_COC_FileMH463... | <img> |
Внутренние ссылки главной страницы ( 2 ) | |
?s= | Suche |
# | Accept / Akzeptieren |
Domain: friwo-batterien.de
Nserver: ns1.opportunity.de
Nserver: ns2.opportunity.de
Status: connect
Changed: 2013-11-11T12:08:31+01:00
США - Нью-Йорк - 12.20.188.4
Maxell Corporation Of America
AT&T Services
HTTP/1.1 200 OK
Date: Tue, 18 Jun 2019 11:53:36 GMT
Server: Apache/2.4.29 (Ubuntu)
Strict-Transport-Security: max-age=15768000;
X-Pingback: https://www.friemann-wolf.de/xmlrpc.php
Link: ; rel="https://api.w.org/"
Link: ; rel=shortlink
Vary: Accept-Encoding
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
Кнопка для анализа сайта в один клик, для установки перетащите ссылку на "Панель закладок"