Возраст домена | 15 лет |
Дата окончания | Истек срок регистрации |
ИКС | |
Страниц в Google | 367 |
Страниц в Яндексе | 20 |
Dmoz | Нет |
Яндекс Каталог | Нет |
Alexa Traffic Rank | Нет данных |
Alexa Country | Нет данных |
История изменения показателей | Авторизация |
Идет сбор информации... Обновить
n/a
n/a
n/a
UTF-8
0.27 КБ
12
87 симв.
74 симв.
Данные предоставлены сервисом semrush
Сайт | Общие фразы | PR | тИЦ | Alexa Rank | Alexa Country | |
---|---|---|---|---|---|---|
rockdalefamilypractice.com | 4 | n/a | 0 | 3929459 | 747284 | |
doctorfelton.com | 4 | n/a | 0 | 15241725 | Нет данных | |
mybfp.com | 4 | n/a | 0 | 23112078 | Нет данных | |
drjacksfamilypractice.com | 4 | n/a | 0 | Нет данных | Нет данных | |
dfmoc.com | 3 | n/a | 0 | 20298801 | Нет данных | |
bivensortho.com | 2 | n/a | 0 | 11744690 | Нет данных | |
bivensandsilvey.com | 1 | 2 |
0 | Нет данных | Нет данных | |
dekalbmedicalclinic.com | 1 | n/a | 0 | 9958214 | Нет данных | |
kendrickfamilycarpetcleaning.com | 1 | n/a | 0 | Нет данных | Нет данных | |
comprehensivevetequinedentistry.com | 1 | 2 |
0 | Нет данных | Нет данных | |
Еще 40 сайтов после авторизации |
Данные предоставлены сервисом semrush
Счетчик | Посетители за 24 часа | Просмотры | Просмотров на посетителя |
---|---|---|---|
Google Analytics | Нет доступа | Нет доступа | n/a |
Domain Name: kendrickmdfp.com
Registry Domain ID:
Registrar WHOIS Server: whois.srsplus.com
Registrar URL: http://srsplus.com
Updated Date: 2014-12-08T14:00:48Z
Creation Date: 2008-10-03T15:16:57Z
Registrar Registration Expiration Date: 2018-10-03T15:16:57Z
Registrar: TLDS LLC. d/b/a SRSPlus
Registrar IANA ID: 320
Registrar Abuse Contact Email: abuse@web.com
Registrar Abuse Contact Phone: +1.8773812449
Reseller:
Domain Status: clientTransferProhibited http://icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name: PERFECT PRIVACY, LLC
Registrant Organization:
Registrant Street: 12808 Gran Bay Pkwy West
Registrant City: Jacksonville
Registrant State/Province: FL
Registrant Postal Code: 32258
Registrant Country: US
Registrant Phone: +1.9027492701
Registrant Phone Ext.:
Registrant Fax:
Registrant Fax Ext.:
Registrant Email: 3ih95p3v9shoc8jlthq3ih4fh3@domaindiscreet.com
Registry Admin ID:
Admin Name: PERFECT PRIVACY, LLC
Admin Organization:
Admin Street: 12808 Gran Bay Pkwy West
Admin City: Jacksonville
Admin State/Province: FL
Admin Postal Code: 32258
Admin Country: US
Admin Phone: +1.9027492701
Admin Phone Ext.:
Admin Fax:
Admin Fax Ext.:
Admin Email: 758e2rb5sihl7b8b2u06n5vaak@domaindiscreet.com
Registry Tech ID:
Tech Name: PERFECT PRIVACY, LLC
Tech Organization:
Tech Street: 12808 Gran Bay Pkwy West
Tech City: Jacksonville
Tech State/Province: FL
Tech Postal Code: 32258
Tech Country: US
Tech Phone: +1.9027492701
Tech Phone Ext.:
Tech Fax:
Tech Fax Ext.:
Tech Email: 758e2rb5sihl7b8b2u06n5vaak@domaindiscreet.com
Name Server: dns1.srsplus.com
Name Server: dns2.srsplus.com
>>> Last update of WHOIS database: 2014-12-08T14:00:48Z <<<
For more information on Whois status codes, please visit https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en.
The data in SRSPlus's WHOIS database is provided to you by
SRSPlus for information purposes only, that is, to assist you in
obtaining information about or related to a domain name registration
record. SRSPlus makes this information available "as is," and
does not guarantee its accuracy. By submitting a WHOIS query, you
agree that you will use this data only for lawful purposes and that,
under no circumstances will you use this data to: (1) allow, enable,
or otherwise support the transmission of mass unsolicited, commercial
advertising or solicitations via direct mail, electronic mail, or by
telephone; or (2) enable high volume, automated, electronic processes
that apply to SRSPlus (or its systems). The compilation,
repackaging, dissemination or other use of this data is expressly
prohibited without the prior written consent of SRSPlus.
SRSPlus reserves the right to modify these terms at any time.
By submitting this query, you agree to abide by these terms.
#robots.txt for all our sites
User-agent: *
Disallow: /contact_us.php
США - 173.201.98.128
GoDaddy.com, LLC
GoDaddy.com, LLC
HTTP/1.1 200 OK
Date: Thu, 11 Oct 2018 11:19:25 GMT
Server: Apache
Set-Cookie: vsid=917vr2868023657937062; expires=Tue, 10-Oct-2023 11:19:25 GMT; Max-Age=157680000; path=/; domain=kendrickmdfp.com; HttpOnly
Content-Length: 272
Content-Type: text/html; charset=UTF-8
Кнопка для анализа сайта в один клик, для установки перетащите ссылку на "Панель закладок"