Возраст домена | 14 лет |
Дата окончания | Истек срок регистрации |
PR | 2 |
ИКС | 0 |
Страниц в Google | 133 |
Страниц в Яндексе | 98 |
Dmoz | Нет |
Яндекс Каталог | Нет |
Alexa Traffic Rank | 10365085 |
Alexa Country | Нет данных |
История изменения показателей | Авторизация |
Идет сбор информации... Обновить
Rolling Tarp Systems Rolling Tarps - LCS USA
n/a
Rolling Load Covering Tarps Flatbeds Double Drop-deck Trailers Truck Bodies Specialied Rolling Tarps Rolltops Flatbed Trailer Canopies Protective Load Covers
UTF-8
18.81 КБ
208
1 484 симв.
1 270 симв.
Данные предоставлены сервисом semrush
Сайт | Общие фразы | PR | тИЦ | Alexa Rank | Alexa Country | |
---|---|---|---|---|---|---|
![]() ![]() |
54 | 9 |
0 | 2 | ![]() | |
![]() ![]() |
26 | 8 |
0 | 42 | ![]() | |
![]() ![]() |
21 | 2 |
0 | 2716460 | ![]() |
|
![]() |
21 | 2 |
0 | 871156 | ![]() | |
![]() ![]() |
20 | 8 |
0 | 10 | ![]() | |
![]() ![]() |
19 | 3 |
0 | 6608926 | ![]() |
|
![]() |
18 | 3 |
0 | 566134 | ![]() | |
![]() ![]() |
15 | 4 |
0 | 81846 | ![]() | |
![]() ![]() |
15 | 5 |
0 | 16980 | ![]() | |
![]() |
14 | 3 |
0 | 3320426 | ![]() |
|
Еще 40 сайтов после авторизации |
Данные предоставлены сервисом semrush
Данные linkpad ( 22 Февраля 2015 ) | |
Количество ссылок на сайт | 85 |
Количество доменов, которые ссылаются на сайт | 10 |
Количество найденных анкоров | 8 |
Исходящие (внешние) ссылки домена | 204 |
Количество доменов, на которые ссылается сайт | 17 |
Количество исходящих анкоров | 14 |
Внешние ссылки главной страницы ( 10 ) | |
slidingtarpsystems.com | Flat Top Modular System (off site) |
loadcoveringtrailers.com | LCT - Non Semi Trailer Covers |
turfsider.com | Roll Up Curtain System |
airtabs.ca | Airtab Fuel Savers (off site) |
slidingtarpsystems.com/kingslingmonstertruck.htm | <img> |
slidingtarpsystems.com/slidekitphotos.htm | Click to see more Slide Kit Tarp System Photos |
ops.fhwa.dot.gov/freight/publications/size_regs_final_rpt/in... | Federal Size Regulations for Commercial Motor Vehicles |
transporttopicsbuyersguide.com | American Transport Topic Buyer's Guide |
piimx.com/militaryveterans/ | <img> |
imarket.ca | <img> |
Внутренние ссылки главной страницы ( 62 ) | |
requestform.htm | Information Request Form |
great8brochure1.htm | 8 ROLL TOP Selections |
windmaster.htm | <img> |
gr8look.htm | Windmaster GR8LOOK Rolling Tarp System |
retractablecanopysteelhaulingtrailers.htm | SLIDE KIT™ Dome Roof Steel Haulers System |
great8brochure2.htm | I-Slide3 & 4 Basic Flat Top System |
side-curtain-system.htm | LCS Hard Top-Soft Side Curtain Systems |
quickslide.htm | Quickslide Curtain System ™ |
livehaulsidecurtainsystems.htm | Live Haul Side Curtain Systems |
side-kits.htm | Side Kits System - Post/Bow/Tarp |
rollingtarpsystemrepairs.htm | Service Repairs of all Systems |
tractortrailerdigitalprintadvetisingslidingtarpsrollingtarps... | <img> |
tractortrailerdigitalprintadvetisinghardsidedframesystem.htm | Hard Side Trailers & Bodies |
rollport.htm | Retractable/Rolling Portable Shelters |
wastedumptarpsystems.htm | Waste Systems |
overcenterpivotdumpcovers.htm | Over Center Pivot Dump Covers |
pullstylemanualdumptarpsystems.htm | Pull Style Covers |
retractablecover-manualcabledumpsystems.htm | Retractable Covers |
siderollcovers.htm | Side Roll Covers |
retractastraprecoilingwinchstrap.htm | Retract-A-Strap |
lockablechainracks.htm | Lockable Chain Racks |
crossbowstoragecompartments.htm | Cross Bow Storage Compartment |
underrackstoragecompartments.htm | Under Rack Storage Compartments |
cargo-control-equipment.htm | Cargo Equipment |
storage-boxes.htm | Storage Boxes |
bulkheads.htm | Bulkheads |
load-levelers.htm | Load Levelers & Ramps |
headacheracks.htm | Headache Racks |
windskirtsvantrailers.htm | Windskirts for Van Trailers |
windskirtsflatbeds.htm | Windskirts for Flatbeds |
multitierdeckingrollingtarpsystems.htm | Multi Tier Decking |
custommadetarpaulinstractortrailers.htm | Tarp Technology Innovation Overview |
flatbedslidingtarpaulins.htm | Flatbed Sliding Tarpaulins |
flatbedsidecurtains.htm | Flatbed Side Curtains |
sidekitcustomcover.htm | Side Kit & Custom Covers |
lumbersteelflattarps.htm | Lumber, Steel, Flat Tarps |
dumptrucktrailertarps.htm | Dump Truck & Trailers |
tractortrailertarprepairs.htm | Repairs |
contractservciescustomtarps.htm | Contract Services |
privacypolicy.htm | Privacy Policy |
index.htm | Home |
brochures/lcs_usa_all_products_brochure2013.pdf | All Products Brochure (.pdf) |
video-popup21.htm | <img> |
video-popup19.htm | <img> |
video-popup20.htm | Video for Slidekit Steel Hauler's Dome Top Sliding System |
veteranaffairs.htm | <img> |
canada.htm | <img> |
contact.htm | <img> |
dealers.htm | <img> |
video.htm | <img> |
allbrochures.htm | <img> |
socialmedia.htm | <img> |
obl.htm | <img> |
greatamericantruckingshow.htm | <img> |
goneglobal.htm | <img> |
trademarks.htm | Trademarks & Patents |
specializedrolltopstarps.htm | Specialized Load Covering |
# | Media Releases |
2016brochures/powair.pdf | POWAIR Front Locks |
2016brochures/highimpacttrack.pdf | HIGH IMPACT BUMP BAR |
video-popup8.htm | Loc'N-Load |
news/jan17news.pdf | January 2017 News |
Domain Name: loadcovering.com
Registry Domain ID: 1588549272_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.Namescout.com
Registrar URL: http://www.Namescout.com
Updated Date: 2015-08-07T17:03:53Z
Creation Date: 2010-03-12T17:25:03Z
Registrar Registration Expiration Date: 2016-03-12T17:25:03Z
Registrar: Namescout.com
Registrar IANA ID: 186
Registrar Abuse Contact Email: abuse@internic.ca
Registrar Abuse Contact Phone: 1-613-820-4374
Reseller: Internic.ca
Domain Status: CLIENT_TRANSFER_PROHIBITED
Domain Status: CLIENT_UPDATE_PROHIBITED
Domain Status:
Domain Status:
Domain Status:
Domain Status:
Registry Registrant ID:
Registrant Name: Tony Fantucchio
Registrant Organization: Load Covering Solutions Ltd.
Registrant Street: 5499 Harvester Road
Registrant City: Burlington
Registrant State/Province: ON
Registrant Postal Code: L7L5V4
Registrant Country: CA
Registrant Phone: +1.905-335-2012
Registrant Phone Ext:
Registrant Fax: +1.905-336-8499
Registrant Fax Ext:
Registrant Email: tonyf@loadcovering.com
Registry Admin ID:
Admin Name: Tony Fantucchio
Admin Organization: Load Covering Solutions Ltd.
Admin Street: 5499 Harvester Road
Admin City: Burlington
Admin State/Province: ON
Admin Postal Code: L7L5V4
Admin Country: CA
Admin Phone: +1.905-335-2012
Admin Phone Ext:
Admin Fax: +1.905-336-8499
Admin Fax Ext:
Admin Email: tonyf@loadcovering.com
Registry Tech ID:
Tech Name: Tony Fantucchio
Tech Organization: Load Covering Solutions Ltd.
Tech Street: 5499 Harvester Road
Tech City: Burlington
Tech State/Province: ON
Tech Postal Code: L7L5V4
Tech Country: CA
Tech Phone: +1.905-335-2012
Tech Phone Ext:
Tech Fax: +1.905-336-8499
Tech Fax Ext:
Tech Email: tonyf@loadcovering.com
Name Server: BSERV-MAIL.BSERV.COM
Name Server: NS1B.BSERV.COM
Name Server:
Name Server:
Name Server:
Name Server:
>>> Last update of WHOIS database: 2015-09-14T20:30:36Z <<<
The results are provided by Namescout.com.
(whois.Namescout.com)
By using Namescout.com's WHOIS database, you confirm that you understand
the following, and you agree to be bound by the terms of usage and
limitations of warranty contained herein.
Although the data contained in Namescout.com's WHOIS database is believed
by the company to be reliable, it is provided "as is". Namescout.com
provides no guarantee or warranty regarding its accuracy and will not
be held liable for any damages resulting from any inaccurate
information that may be included in the database. Namescout.com's sole
purpose for providing this information is to assist you in acquiring
information about domain name registration records. Any use of this
data for any other purpose is expressly prohibited without the prior
written permission of Namescout.com. By submitting a query to Namescout.com,
you agree to the terms contained herein and in particular, you agree
not to use this data to allow, enable, or otherwise make possible,
distribution or collection of this data, in part or in its entirety,
for any purpose, such as the transmission of unsolicited advertising
and solicitations of any kind, including spam. You further agree not to
use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial
purposes.
Register your domain now at www.Namescout.com
Sitemap: http://www.loadcovering.com/sitemap.xml
США - Атланта - 74.207.225.74
Global Net Access, LLC
Linode
HTTP/1.1 200 OK
Last-Modified: Tue, 20 Aug 2019 01:29:49 GMT
Content-Type: text/html
Content-Length: 19262
Accept-Ranges: bytes
Date: Mon, 30 Sep 2019 15:36:07 GMT
Server: LiteSpeed
Alt-Svc: quic=":443"; ma=2592000; v="35,39,43,44"
Connection: Keep-Alive
Кнопка для анализа сайта в один клик, для установки перетащите ссылку на "Панель закладок"