Возраст домена | 10 лет |
Дата окончания | Истек срок регистрации |
ИКС | n/a |
Страниц в Google | n/a |
Страниц в Яндексе | n/a |
Dmoz | Нет |
Яндекс Каталог | Нет |
Alexa Traffic Rank | 16933324 |
Alexa Country | Нет данных |
История изменения показателей | Авторизация |
Идет сбор информации... Обновить
MaltaDeals4U - Great Deals & Discounts for Malta & Gozo
n/a
n/a
UTF-8
86.71 КБ
1 404
10 917 симв.
8 917 симв.
Идет сбор информации... Обновить
Идет сбор информации... Обновить
Данные linkpad ( 9 Августа 2017 ) | |
Количество ссылок на сайт | 12 |
Количество доменов, которые ссылаются на сайт | 7 |
Количество найденных анкоров | 12 |
Исходящие (внешние) ссылки домена | 792 |
Количество доменов, на которые ссылается сайт | 22 |
Количество исходящих анкоров | 24 |
Внешние ссылки главной страницы ( 1 ) | |
brokenaxe.com | Brokenaxe |
Внутренние ссылки главной страницы ( 130 ) | |
/ | Home |
/signin | Sign In |
/howitworks | How it Works? |
/recent | Recent |
/beautywellness | Beauty & Wellness |
/dining | Dining |
/jewelleryperfumes | Jewellery & Perfumes |
/getaways | Getaways |
/products | Products |
/services | Services |
/quotations | Quotations |
/deals/soseazytrackoffervalidforalimitedperiod | New SOS-Eazy TrackSOS-Eazy TrackSOS-Eazy TrackSOS-Eazy TrackSOS-Eazy TrackSOS-Eazy Track SOS-Eazy Track - OF... |
/deals/fullyloadedmxqpro4kandroidbox6900freekeyboardremote | Hot Seller Fully Loaded MxQPRO 4K Android Box @ €69.00 + FREE KEYBOARD & RE.. Value€ 95.00 Discount38% Price€ 59.00 |
/deals/tvipsboxv605iptv | TVIP S-Box v.605 IPTV by Maltadeals4u.com Price€ 175.00 |
/deals/premiummag3524ksettopbox2018 | New Premium MAG 352 4K Set-Top-Box 2018! by Maltadeals4u.com Value€ 295.00 Discount31% Price€ 205.00 |
/deals/m8sproplus2gbramfullyloadedwith2yearswarranty | New M8S Pro Plus 2GB Ram Fully Loaded with 2 Years Warranty by Malta.. Value€ 160.00 Discount32% Price€ 110.00 |
/deals/m8spro3gbramfullyloadedautomaticupdates2yearswarranty | New M8S Pro 3GB Ram Fully Loaded, Automatic Updates, 2 Years Warrant.. Value€ 225.00 Discount32% Price€ 155.00 |
/deals/technologytoolsfordyslexiacourseandotherspecialneeds | New Technology Tools for Dyslexia Course and other Special needs by .. Value€ 350.00 Discount6% Price€ 330.00 |
/deals/specialglowinthedarkmagictrackwithledracecarincluded | Special SPECIAL! Glow in the Dark Magic Track with LED Race Car Included.. Value€ 75.00 Discount40% Price€ 29.00 |
/deals/solarpoweredautocarcoolforthishotsummer | Special Solar Powered Auto Car Cool For This HOT Summer by Maltadeals4u... Value€ 29.90 Discount34% Price€ 15.00 |
/deals/actionsportscamerafullhd1080pdivingwaterproof | Hot Seller Action Sports Camera Full HD 1080P Diving Waterproof by Maltadea.. Value€ 85.00 Discount31% Price€ 59.00 |
/deals/twowheelelectrichoverboardskateboardwithbluetoothspea... | New Two Wheel Electric Hoverboard/Skateboard with Bluetooth & Speake.. Price€ 299.00 |
/deals/65wportableaircoolerwithairpurifierhumidifierpurifica... | Special 65W Portable Air Cooler with Air Purifier, Humidifier & Purifica.. Value€ 395.00 Discount51% Price€ 195.00 |
/deals/65hoverboardsmartbalancewheelsiliconecover | New 6.5 Hoverboard/Smart Balance Wheel Silicone Cover by Maltadeals4.. Value€ 35.00 Discount46% Price€ 19.00 |
/deals/universalandroidboxremote | New Universal Android Box Remote by Maltadeals4u.com Value€ 9.99 Discount50% Price€ 4.99 |
/deals/wallmountedheaterforbusinesshomeindooroutdoor | Special Wall Mounted Heater for Business/Home Indoor/Outdoor by Maltadea.. Value€ 165.00 Discount43% Price€ 99.00 |
/deals/trampolinewithsafetynetenclosureladderraincover | New Trampoline With Safety Net Enclosure, Ladder & Rain Cover by Mal.. Value€ 589.00 Discount50% Price€ 299.00 |
/deals/50offalacartemenuinsliema | 50% Off A La Carte Menu in Sliema by Le Malte Restaurant Price€ 1.00 |
/deals/buffetlunchdinnerinstpaulsbay | New Buffet Lunch & Dinner in St. Paul`s Bay by Gandhi Tandoori India.. Value€ 14.85 Discount33% Price€ 11.50 |
/deals/50offalacartemenuinstpaulsbay | 50% Off A La Carte Menu in St. Paul`s Bay by Gandhi Tandoori Ind.. Price€ 1.00 |
/deals/indianbuffeteverysundaydinnerforjust1150 | New Indian Buffet every Sunday Dinner for just €11.50 by Gandhi Tand.. Value€ 14.85 Discount26% Price€ 11.50 |
/deals/q18smartwristwatchforandroidoriphones | Hot Seller Q18 Smart Wrist Watch For Android or iPhones by Maltadeals4u.com Value€ 59.90 Discount51% Price€ 29.90 |
/deals/tvipv410settopbox | New TVIP v.410 Set Top Box by Maltadeals4u.com Value€ 195.00 Discount40% Price€ 120.00 |
/deals/mag322tvsettopbox | New MAG 322 TV Set Top Box by Maltadeals4u.com Value€ 245.00 Discount41% Price€ 130.00 |
/deals/subscribefor3monthspremiumiptvchannellist | Hot Seller Subscribe for 3 Months Premium IPTV Channel List by Maltadeals4u.. Value€ 80.00 Discount50% Price€ 40.00 |
/deals/subscribefor6monthspremiumiptvchannellist | New Subscribe for 6 Months Premium IPTV Channel List by Maltadeals4u.. Value€ 150.00 Discount50% Price€ 70.00 |
/deals/subscribefor1yearpremiumiptvchannellist | New Subscribe for 1 Year Premium IPTV Channel List by Maltadeals4u.c.. Value€ 240.00 Discount50% Price€ 120.00 |
/deals/50off5drivinglessons | New 50% Off 5 Driving Lessons by Groove Motoring School Value€ 60.00 Discount50% Price€ 30.00 |
/deals/tplink300mbpswirelessrangeextender | New TP-Link 300Mbps Wireless Range Extender by Maltadeals4u.com Price€ 29.90 |
/deals/tplinkhomeplugsav500nanopowerlineadapter | New TP-Link Home Plugs - AV500 Nano Powerline Adapter by Maltadeals4.. Price€ 44.90 |
/deals/miniwirelessblackwhitekeyboardmousecombo | New Mini Wireless Black/White Keyboard & Mouse Combo by Maltadeals4u.. Value€ 32.00 Discount39% Price€ 19.00 |
/deals/fullsetgelnails | New Full Set Gel Nails by Get Nail`d Value€ 20.00 Discount25% Price€ 15.00 |
/deals/nailinfills | New Nail Infills by Get Nail`d Value€ 15.00 Discount20% Price€ 12.00 |
/deals/nailgelish | New Nail Gelish by Get Nail`d Value€ 10.00 Discount30% Price€ 7.00 |
/deals/droneforfunplaywithextendablecameraoptional | New Drone for Fun Play with Extendable Camera (Optional) by Maltadea.. Value€ 119.90 Discount42% Price€ 69.90 |
/deals/bestcheapestdealsonhotelsinmaltaeurope | Best & Cheapest Deals on Hotels in Malta & Europe |
/deals/indianorchinese5coursesetmenu55off | New Indian or Chinese 5 Course Set Menu @ 55% OFF by Incredible Asia Value€ 25.80 Discount55% Price€ 11.75 |
/deals/cctvwirelesscamerapackage4ipcamerasdvrremoteviewing | New CCTV Wireless Camera Package - 4 IP Cameras, DVR, Remote Viewing.. Value€ 900.00 Discount62% Price€ 350.00 |
/deals/cctvwirelesscamerapackage4ipcamerasdvrwithbuiltinmoni... | New CCTV Wireless Camera Package - 4 IP Cameras, DVR with Built-in M.. Value€ 990.00 Discount61% Price€ 395.00 |
/deals/collagenfacetreatmentandbackmassage | New Collagen Face Treatment and Back Massage by Beauty Point Wellnes.. Value€ 64.00 Discount57% Price€ 28.00 |
/deals/laserhairremoval | New Laser Hair Removal by Beauty Point Wellness Centre Value€ 90.00 Discount50% Price€ 45.00 |
/deals/electricscooter | New Electric Scooter by Maltadeals4u.com Value€ 299.00 Discount33% Price€ 199.00 |
/deals/saturdayonlychineseindianeatasmuchasyoulikebuffet | New Saturday only! Chinese & Indian Eat as much as you like Buffet b.. Value€ 23.90 Discount50% Price€ 11.95 |
/deals/6monthslaserhairremovalunlimitedareas | New 6 Months Laser Hair Removal - Unlimited Areas by Beauty Point We.. Value€ 200.00 Discount50% Price€ 99.00 |
/deals/50offalacartemenuinxemxija | 50% Off A La Carte Menu in Xemxija by Shaukiwan Price€ 1.00 |
/deals/allinclusivesetmenu | Recommended All Inclusive Set Menu by Le Malte Restaurant Value€ 50.00 Discount40% Price€ 30.00 |
/deals/chromesilver2wheeladultkidsscooter | Special Chrome Silver 2 Wheel Adult/Kids Scooter by Maltadeals4u.com Value€ 115.00 Discount35% Price€ 75.00 |
/deals/mouthwatering5coursemeal | Mouth Watering 5 Course Meal by Selmun Bar & Restaurant Value€ 32.00 Discount50% Price€ 16.00 |
/deals/aquamarinesilvercrystalnecklacebraceletearringsringse... | Hot Seller Aquamarine Silver Crystal Necklace, Bracelet, Earrings & Ring Se.. Value€ 55.95 Discount73% Price€ 14.95 |
/deals/whitesilvercrystalnecklacebraceletearringsringset | Hot Seller White Silver Crystal Necklace, Bracelet, Earrings & Ring Set by .. Value€ 55.95 Discount73% Price€ 14.95 |
/deals/shamballaaquamarinewhitecrystalnecklacependant | Shamballa Aquamarine/White Crystal Necklace Pendant by Maltadeal.. Value€ 35.90 Discount81% Price€ 6.90 |
/deals/silverplatedcrystalcrossnecklace | Silver Plated Crystal Cross Necklace by Maltadeals4u.com Value€ 22.00 Discount73% Price€ 5.95 |
/deals/aquamarinecrystalbutterflynecklace | Aquamarine Crystal Butterfly Necklace by Maltadeals4u.com Value€ 29.99 Discount80% Price€ 5.95 |
/deals/waterdropcrystalpinkaquamarinenecklace | Water drop Crystal Pink/Aquamarine Necklace by Maltadeals4u.com Value€ 29.99 Discount80% Price€ 5.95 |
/deals/diamondcrystalaquamarinenecklacependant | Diamond Crystal Aquamarine Necklace Pendant by Maltadeals4u.com Value€ 21.95 Discount73% Price€ 5.95 |
/deals/silverplatedrounddaintybracelet | Silver Plated Round Dainty Bracelet by Maltadeals4u.com Value€ 22.90 Discount70% Price€ 6.90 |
/deals/silverbluependantnecklaceearrings | Silver & Blue Pendant Necklace & Earrings by Maltadeals4u.com Value€ 35.00 Discount76% Price€ 8.50 |
/deals/silverblackcrystalnecklaceearrings | Silver & Black Crystal Necklace & Earrings by Maltadeals4u.com Value€ 35.00 Discount76% Price€ 8.50 |
/deals/silverplateddarkbluestonesnecklaceearrings | Silver Plated & Dark Blue Stones Necklace & Earrings by Maltadea.. Value€ 31.50 Discount75% Price€ 7.90 |
/deals/silverplatedblackcrystalnecklaceearrings | Silver Plated & Black Crystal Necklace & Earrings by Maltadeals4.. Value€ 31.50 Discount75% Price€ 7.90 |
/deals/silverbluealloynecklaceearrings | Silver & Blue Alloy Necklace & Earrings by Maltadeals4u.com Value€ 29.00 Discount75% Price€ 7.50 |
/deals/silvergreyalloynecklaceearrings | Silver & Grey Alloy Necklace & Earrings by Maltadeals4u.com Value€ 29.00 Discount75% Price€ 7.50 |
/deals/silveryellowallownecklaceearrings | Silver & Yellow Allow Necklace & Earrings by Maltadeals4u.com Value€ 29.00 Discount75% Price€ 7.50 |
/deals/silverplatedwaterdropblackpendantnecklaceearrings | Silver Plated Water Drop Black Pendant Necklace & Earrings by Ma.. Value€ 25.00 Discount72% Price€ 7.10 |
/deals/tibetansilverhollowblackpendantnecklaceearrings | Tibetan Silver Hollow Black Pendant Necklace & Earrings by Malta.. Value€ 25.00 Discount72% Price€ 7.10 |
/deals/blacktibetansilverroundnecklaceearrings | Black Tibetan Silver Round Necklace & Earrings by Maltadeals4u.c.. Value€ 25.00 Discount72% Price€ 7.10 |
/deals/flowersilvercrystalpendantnecklaceearrings | Flower Silver Crystal Pendant Necklace & Earrings by Maltadeals4.. Value€ 40.00 Discount78% Price€ 8.90 |
/deals/silvercrystalsnakenecklaceearrings | Silver Crystal Snake Necklace & Earrings by Maltadeals4u.com Value€ 40.00 Discount78% Price€ 8.90 |
/deals/chandeliersilvercrystalnecklaceearrings | Chandelier Silver Crystal Necklace & Earrings by Maltadeals4u.co.. Value€ 40.00 Discount78% Price€ 8.90 |
/deals/teardropsilvercrystalnecklaceearrings | Tear Drop Silver Crystal Necklace & Earrings by Maltadeals4u.com Value€ 40.00 Discount78% Price€ 8.90 |
/deals/bluetoothstereoheadphones | New Bluetooth Stereo Headphones by Maltadeals4u.com Value€ 84.90 Discount60% Price€ 34.90 |
/deals/flyingfishforages8 | New Flying Fish for Ages 8+ by Maltadeals4u.com Value€ 119.99 Discount63% Price€ 45.00 |
/deals/dafiinstantwaterheaterskwh374555732yearwarranty | Dafi Instant Water Heaters: Kwh 3.7/4.5/5.5/7.3 (2 year warranty.. Price€ 95.00 |
/deals/dafiinstantwaterheaterskwh902yearwarranty | Dafi Instant Water Heaters: Kwh 9.0 (2 year warranty) by Maltade.. Price€ 115.00 |
/deals/wijasperfectinstandwaterheaterkwh354550 | New Wijas Perfect Instand Water Heater KwH: 3.5/4.5/5.0 by Maltadeal.. Value€ 195.00 Discount43% Price€ 112.00 |
/deals/solarcompatiblewaterheaterskwh354457 | New Solar Compatible Water Heaters: KwH 3.5/4.4/5.7 by Maltadeals4u... Price€ 250.00 |
/deals/pestsystemslp22lp324pack | PestSystems LP22 & LP32 (4 pack) by Maltadeals4u.com Value€ 143.00 Discount20% Price€ 114.40 |
/deals/pestsystemslp22 | PestSystems LP22 by Maltadeals4u.com Value€ 84.00 Discount20% Price€ 67.20 |
/deals/1wirelessipsecurityhdcamera | New 1 Wireless IP Security HD Camera by Maltadeals4u.com Value€ 190.00 Discount48% Price€ 99.00 |
/deals/experiencemaltainanewdimension | Experience Malta in a new Dimension by Malta 5D Value€ 9.00 Discount22% Price€ 7.00 |
/deals/musicperformercourse | New Music Performer Course by Instant Musician School Value€ 240.00 Discount13% Price€ 210.00 |
/deals/websitedesigndevelopment | Website Design & Development by Rubix Creations Value€ 400.00 Discount13% Price€ 350.00 |
/deals/therapeuticenergyflowmassage | Therapeutic Energyflow Massage by Access Energy Flow Value€ 70.00 Discount50% Price€ 35.00 |
/deals/signaturerejuvenatingfacialfor25hours | Signature Rejuvenating Facial for 2.5 hours by Nefertari Beauty .. Value€ 75.00 Discount40% Price€ 45.00 |
/deals/holidaywax | Holiday Wax by Nefertari Beauty & Slimming Clinic Value€ 36.00 Discount39% Price€ 22.00 |
/deals/fullbodypolishneckandshouldermassage | Full Body Polish, Neck and Shoulder Massage by Nefertari Beauty .. Value€ 75.00 Discount47% Price€ 49.50 |
/deals/blowdryhairtreatmentgelpolishfullset | Blow Dry, Hair Treatment & Gel Polish Full Set by Serenity Hair .. Value€ 50.00 Discount23% Price€ 38.50 |
/deals/waxingfulllegseyelipsunderarmsarms | Waxing - Full Legs, Eye & Lips, Underarms & Arms by Serenity Hai.. Value€ 40.00 Discount17% Price€ 33.50 |
/deals/changeyourlifearoundandkeepitthatway | Change Your Life Around and Keep It That Way by Nefertari Beauty.. Value€ 260.00 Discount33% Price€ 174.00 |
/deals/manicurepedicuregelpolishfullsethandsfeet | Manicure, Pedicure & Gel Polish Full Set (Hands/Feet) by Serenit.. Value€ 60.00 Discount18% Price€ 49.50 |
/deals/20hoursofenglishclassesinmarsascala | New 20 Hours of English Classes in Marsascala by English Lessons Value€ 300.00 Discount34% Price€ 200.00 |
/deals/spatreatmentsforthemindbody | Spa Treatments for the Mind & Body by Hotel Xlendi Value€ 105.00 Discount40% Price€ 63.00 |
/deals/fullsetnailsgel | Full Set Nail`s Gel by Greta`s Nail Room Value€ 35.00 Discount29% Price€ 25.00 |
/deals/fullheadcolourblowdrycuthairtreatment | Full Head Colour, Blow Dry, Cut & Hair Treatment by Serenity Hai.. Value€ 65.00 Discount24% Price€ 49.50 |
/deals/foodhandlingcourse | Food Handling Course by Food Safety Assurance Value€ 40.00 Discount30% Price€ 28.00 |
/deals/colourcutblowdry | Colour, Cut & Blowdry by R Unique Value€ 45.00 Discount22% Price€ 35.00 |
/deals/50off1hourgig | 50% Off 1 Hour Gig by Infinite Loop Value€ 300.00 Discount50% Price€ 150.00 |
/deals/pianoandmusictheorylessons | Piano and Music Theory Lessons by Stephanie’s Piano School Value€ 22.50 Discount49% Price€ 11.50 |
/deals/keratintreatmentmanicurepedicure | Keratin Treatment & Manicure/Pedicure by R Unique Value€ 105.00 Discount38% Price€ 65.00 |
/deals/faceliftingpackage | Face Lifting Package by Nefertari Beauty & Slimming Clinic Value€ 140.00 Discount68% Price€ 45.00 |
/deals/cornucopiafromjust22person | Cornucopia From Just €22/Person. by Maltadeals4u.com Price€ 44.00 |
/deals/dolmenhotelfromjust2250person | Dolmen Hotel From Just €22.50/Person by Maltadeals4u.com Price€ 45.00 |
/deals/grandexcelsiorfromjust53person | Grand Excelsior From Just €53/Person by Maltadeals4u.com Price€ 106.00 |
/deals/marinacorinthiabeachfromjust3450person | Marina Corinthia Beach From Just €34.50/Person by Maltadeals4u.c.. Price€ 69.00 |
/deals/sunnycoastresortspafromjust2350person | Sunny Coast Resort & Spa From Just €23.50/Person by Maltadeals4u.. Price€ 47.00 |
/deals/pergolaclubhotelspafromjust900person | Pergola Club Hotel & Spa From Just €9.00/Person. by Maltadeals4u.. Price€ 18.00 |
/deals/maritimantoninehotelspafromjust25person | Maritim Antonine Hotel & Spa From Just €25/Person by Maltadeals4.. Price€ 50.00 |
/deals/hotelsinmanchesterenglandstartingfromonly2325person | Hotels in Manchester England starting from only €23.25/Person by.. Price€ 46.50 |
/deals/hotelsinlondonfromjust2450person | Hotels in London From Just €24.50/Person by Maltadeals4u.com Price€ 49.00 |
/deals/hotelsinmadridspainstartingfromonly15person | Hotels in Madrid Spain starting from only €15/Person by Maltadea.. Price€ 30.00 |
/deals/hotelsinibizaspainstartingfromonly1650person | Hotels in Ibiza Spain starting from only €16.50/Person by Maltad.. Price€ 33.00 |
/deals/hotelsinathensgreecestartingfromonly10person | Hotels in Athens Greece starting from only €10/Person by Maltade.. Price€ 20.00 |
/deals/hotelsinparisfrancefromjust19person | Hotels in Paris France From Just €19/Person by Maltadeals4u.com Price€ 38.00 |
/deals/hotelsindisneylandparisfromjust2550person | Hotels in Disneyland Paris From Just €25.50/Person by Maltadeals.. Price€ 51.00 |
/deals/hotelsincostabravaspainfromjust23person | Hotels In Costa Brava Spain From Just €23/Person by Maltadeals4u.. Price€ 46.00 |
/deals/keepitcleangarageexternalwashonly | New Keep It Clean Garage ( External Wash Only ) by Keep It Clean Gar.. Value€ 17.00 Discount30% Price€ 12.00 |
/createadeal | Create a Deal |
/aboutus | About Us |
/contactus | Contact Us |
/termsofuse | Terms of Use |
Domain Name: MALTADEALS4U.COM
Registry Domain ID: 1841907540_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.joker.com
Registrar URL: http://www.joker.com
Updated Date: 2017-12-27T09:13:39Z
Creation Date: 2014-01-08T10:50:06Z
Registry Expiry Date: 2019-01-08T10:50:06Z
Registrar: CSL Computer Service Langenbach GmbH d/b/a joker.com
Registrar IANA ID: 113
Registrar Abuse Contact Email: abuse@joker.com
Registrar Abuse Contact Phone: +49.21186767447
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: A.NS.JOKER.COM
Name Server: B.NS.JOKER.COM
Name Server: C.NS.JOKER.COM
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2018-07-15T07:42:46Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar. Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.
TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.
The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.
Нидерланды - 141.138.196.73
CloudVPS
CloudVPS
HTTP/1.1 200 OK
Cache-Control: private
Content-Type: text/html; charset=utf-8
Server: Microsoft-IIS/8.0
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
Date: Sun, 15 Jul 2018 07:42:08 GMT
Content-Length: 88792
Кнопка для анализа сайта в один клик, для установки перетащите ссылку на "Панель закладок"