Возраст домена | 17 лет |
Дата окончания | Истек срок регистрации |
PR | 2 |
ИКС | n/a |
Страниц в Google | 5800 |
Страниц в Яндексе | 1 |
Dmoz | Нет |
Яндекс Каталог | Нет |
Alexa Traffic Rank | 8633951 |
Alexa Country | 778787 |
История изменения показателей | Авторизация |
Идет сбор информации... Обновить
McCoy Blossom Funeral Homes & Crematory
cremation, pet cremation, cemetery, funeral home, casket, burial, pre-arrangements, family owned & operated, traditional funeral, cremation service
A family owned and operated business in Troy Missouri.
UTF-8
25.08 КБ
412
3 253 симв.
2 713 симв.
Данные предоставлены сервисом semrush
Сайт | Общие фразы | PR | тИЦ | Alexa Rank | Alexa Country | |
---|---|---|---|---|---|---|
mccoyblossomfunerals.com | 8 | 2 |
0 | 4883664 | 647827 | |
kempermillardkeimfamilychapels.com | 6 | n/a | 0 | 12089774 | Нет данных | |
pitmanfuneralhome.com | 3 | 2 |
0 | 1398987 | 255498 | |
bibbveach.com | 3 | n/a | 0 | 6384608 | Нет данных | |
carterricksfuneralhome.com | 2 | 3 |
0 | 7601015 | Нет данных | |
drauckerfuneralhome.com | 1 | n/a | 0 | 24113233 | Нет данных | |
lincolncountyprosecutor.com | 1 | n/a | 0 | 24397528 | Нет данных | |
flowerstroymo.com | 1 | n/a | 0 | Нет данных | Нет данных | |
freerussfaria.us | 1 | n/a | 0 | Нет данных | Нет данных | |
mccoyblossomfh.net | 1 | n/a | 0 | Нет данных | Нет данных | |
Еще 40 сайтов после авторизации |
Данные предоставлены сервисом semrush
Счетчик | Посетители за 24 часа | Просмотры | Просмотров на посетителя |
---|---|---|---|
Google Analytics | Нет доступа | Нет доступа | n/a |
Данные linkpad ( 22 Февраля 2015 ) | |
Количество ссылок на сайт | 15 |
Количество доменов, которые ссылаются на сайт | 4 |
Количество найденных анкоров | 5 |
Исходящие (внешние) ссылки домена | 0 |
Количество доменов, на которые ссылается сайт | 0 |
Количество исходящих анкоров | 0 |
Внешние ссылки главной страницы ( 7 ) | |
centerforloss.com/bookstore/?bid=3&partner=304 | Grief Bookstore |
cremationassociation.org/ | <img> |
nfda.org/ | <img> |
iccfa.com/ | <img> |
ffda.com | <img> |
batesvilletechnology.com | Batesville, Inc. |
batesville.com/helping-families/ | Funeral Planning and Grief Resources |
Внутренние ссылки главной страницы ( 37 ) | |
mccoyblossomfh.com/ | Home |
mccoyblossomfh.com/about | Who We Are |
mccoyblossomfh.com/history | Our Story |
mccoyblossomfh.com/staff | Our Staff |
mccoyblossomfh.com/locations | Our Locations |
mccoyblossomfh.com/schedule | Our Calendar |
mccoyblossomfh.com/contact | Contact Us |
mccoyblossomfh.com/florists | Send Flowers |
mccoyblossomfh.com/obits | Obituaries |
mccoyblossomfh.com/plan/funeral | Plan a Funeral |
/need_now | s:137 (86) /s:137 (86) none |
mccoyblossomfh.com/merchandise | Merchandise |
mccoyblossomfh.com/life_choices | Plan Ahead |
mccoyblossomfh.com/why_preplan | Why Plan Ahead? |
/index.cfm/plan:main/intro/pn/1/fh_id/10842 | Pre-Planning Form |
mccoyblossomfh.com/info | Resources |
mccoyblossomfh.com/griefwords | Grief Library |
mccoyblossomfh.com/insight | Planning Insights |
mccoyblossomfh.com/links | Helpful Links |
mccoyblossomfh.com/extra | Pet Cremations |
/obituary/carrol-stone | Carroll Stone 06/02/56 - 02/12/19 |
/obituary/thomas-tom-wick | Thomas 'Tall Tom' Wick 03/11/56 - 02/12/19 |
/obituary/michael-blevins | Michael Blevins 05/12/49 - 02/11/19 |
/obituary/ruben-mccrackin | Ruben McCrackin 01/12/41 - 02/11/19 |
/obituary/wayne-klippel | Wayne Klippel 02/12/51 - 02/07/19 |
/obituary/maudean-lee | Maudean Lee 10/07/51 - 02/06/19 |
/obituary/cora-davis | Cora Davis 01/28/48 - 02/04/19 |
/obituary/norma-mccarty | Norma McCarty 04/25/34 - 02/04/19 |
/obituary/bruce-hopkins | Bruce Hopkins 08/19/63 - 01/19/19 |
/obituary/steven-steve-brown | Pastor Steven "Steve" Brown 05/20/53 - 01/07/19 |
/obituary/connie-hanshew | Connie Hanshew 04/11/53 - 01/06/19 |
/obituary/brenda-hart | Brenda Hart 07/19/42 - 01/06/19 |
/subscribe | Join our mailing list |
/cdn-cgi/l/email-protection#77041605161f1a1414180e151b180404... | [email protected] |
mccoyblossomfh.com/conditions | Terms of Use |
mccoyblossomfh.com/privacy | Privacy |
/admin/index.cfm?fh_id=10842 | Login |
Domain Name: MCCOYBLOSSOMFH.COM
Registry Domain ID: 554340154_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Update Date: 2015-08-01T15:40:55Z
Creation Date: 2006-08-14T13:37:47Z
Registrar Registration Expiration Date: 2016-08-14T13:37:47Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: eBusiness Support
Registrant Organization: Batesville Casket Company
Registrant Street: One Batesville Blvd
Registrant City: Batesville
Registrant State/Province: Indiana
Registrant Postal Code: 47006
Registrant Country: US
Registrant Phone: 8002976177
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: e-Business.Support@Batesville.com
Registry Admin ID: Not Available From Registry
Admin Name: eBusiness Support
Admin Organization: Batesville Casket Company
Admin Street: One Batesville Blvd
Admin City: Batesville
Admin State/Province: Indiana
Admin Postal Code: 47006
Admin Country: US
Admin Phone: +1.8002976177
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: e-business.support@batesville.com
Registry Tech ID: Not Available From Registry
Tech Name: eBusiness Support
Tech Organization: Batesville Casket Company
Tech Street: One Batesville Blvd
Tech City: Batesville
Tech State/Province: Indiana
Tech Postal Code: 47006
Tech Country: US
Tech Phone: 8002976177
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: e-Business.Support@Batesville.com
Name Server: NS1.PROFITABILITY.NET
Name Server: NS2.PROFITABILITY.NET
Name Server: NS3.PROFITABILITY.NET
>>> Last update of WHOIS database: 2016-01-19T03:00:00Z <<<
For more information on Whois status codes, please visit https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en
User-agent: *
Disallow: /
User-agent: Googlebot
User-agent: Bingbot
User-agent: ia_archiver
Crawl-delay: 5
Disallow: /extras/
Disallow: /fh_live/
Disallow: /images/
Disallow: /info/
Disallow: /print/
Disallow: /templates/
Disallow: /updates/
Disallow: /weather/
Disallow: /aa/
Disallow: /bccadmin/
Disallow: /e-flyers/
Disallow: /erem/
Disallow: /weather/
Disallow: /site/
Disallow: /tables/
Disallow: /temp/
Disallow: /standalones/
Disallow: /BIAdmin/
Disallow: /sched_tasks/
США - Batesville - 199.182.72.119
Hillenbrand
Hillenbrand
HTTP/1.1 200 OK
Date: Sun, 17 Feb 2019 19:29:48 GMT
Content-Type: text/html;charset=UTF-8
Connection: close
Set-Cookie: __cfduid=d9a92a930289c9c73f21f0cb1b611d3bd1550431787; expires=Mon, 17-Feb-20 19:29:47 GMT; path=/; domain=.www.mccoyblossomfh.com; HttpOnly
Set-Cookie: CFID=931bfc33-c44c-4d01-9687-33b8bbf7541f;Path=/;HTTPOnly
Set-Cookie: CFTOKEN=0;Path=/;HTTPOnly
Set-Cookie: __cflb=3799895401; path=/; expires=Sun, 17-Feb-19 20:29:48 GMT; HttpOnly
Server: cloudflare
CF-RAY: 4aaaaa32e90b9568-IAD
Кнопка для анализа сайта в один клик, для установки перетащите ссылку на "Панель закладок"