Возраст домена | 13 лет |
Дата окончания | Истек срок регистрации |
PR | 1 |
ИКС | |
Страниц в Google | 276 |
Страниц в Яндексе | 161 |
Dmoz | Нет |
Яндекс Каталог | Нет |
Alexa Traffic Rank | 12729166 |
Alexa Country | Нет данных |
История изменения показателей | Авторизация |
Идет сбор информации... Обновить
My Vintage Barbies
Ponytail Barbie, Vintage Barbie, Barbie Doll, Midge, Ken, Allan, Skipper, Skooter, Miss Barbie, American Girl, Color Magic, TNT Barbie, Twist n Turn Barbie, Francie, Old Barbie Clothes, Vintage Barbie Clothes, #1 Barbie, #2 Barbie, History of Barbie, Marks on Barbie, Friends and family of Barbie, Reproduction Barbie Dolls, Original Barbie, Barbies ensembles, collecting Barbie, Fashion Dolls, Barbie Clothes, description of Barbie, Standard Barbie, Early Barbie, reproduction Barbies, Mod Barbies
My Vintage Barbies is a comprehensive reference website that showcases Barbie, all her friends and relatives, as well as all of her clothing ensembles and gift sets through the vintage years; 1959-1976. Theres even information on foreign dolls. You will see newer dolls like Silkstone Barbie dolls, Reproduction Barbie dolls, and Christmas Barbie dolls too. This site is a wealth of information and history at your fingertips!
ISO-8859-1
28.72 КБ
735
5 333 симв.
4 486 симв.
Данные предоставлены сервисом semrush
Сайт | Общие фразы | PR | тИЦ | Alexa Rank | Alexa Country | |
---|---|---|---|---|---|---|
ebay.com | 38 | 8 |
0 | 42 | 11 | |
fashion-doll-guide.com | 18 | 3 |
0 | 1357251 | 395097 | |
youtube.com | 15 | 9 |
0 | 2 | 2 | |
dollreference.com | 11 | 4 |
10 | 782503 | 295571 | |
amazon.com | 11 | 8 |
0 | 10 | 4 | |
etsy.com | 10 | 7 |
0 | 152 | 50 | |
flickr.com | 9 | 9 |
0 | 391 | 285 | |
yahoo.com | 8 | 9 |
0 | 9 | 7 | |
pinterest.com | 7 | 9 |
0 | 68 | 27 | |
about.com | 5 | 7 |
0 | 7787 | 3020 | |
thefind.com | 4 | 6 |
0 | 875130 | 184558 | |
toysrus.com | 3 | 6 |
0 | 35966 | 7784 | |
target.com | 3 | 7 |
0 | 467 | 91 | |
Еще 37 сайтов после авторизации |
Данные предоставлены сервисом semrush
Счетчик | Посетители за 24 часа | Просмотры | Просмотров на посетителя |
---|---|---|---|
StatCounter | Нет доступа | Нет доступа | n/a |
Данные linkpad ( 9 Марта 2013 ) | |
Количество ссылок на сайт | 0 |
Количество доменов, которые ссылаются на сайт | 0 |
Количество найденных анкоров | 0 |
Исходящие (внешние) ссылки домена | 746 |
Количество доменов, на которые ссылается сайт | 15 |
Количество исходящих анкоров | 9 |
Внешние ссылки главной страницы ( 9 ) | |
statcounter.com/drupal/ | <img> |
ws-na.amazon-adsystem.com/widgets/q?rt=tf_sw&ServiceVersion=... | Amazon.com Widgets |
rover.ebay.com/rover/1/711-53200-19255-14/1?campid=533724431... | <img> |
rover.ebay.com/rover/1/711-53200-19255-0/1?icep_ff3=9&pub=55... | Buy Barbie Dolls |
myvintagebarbies.blogspot.com/ | Blog |
facebook.com/My-Vintage-Barbiescom-216169491745723/ | |
twitter.com/#!/MyVintageBarbie | |
pinterest.com/marieroyer | |
facebook.com/pages/My-Vintage-Barbiescom/216169491745723 | <img> |
Внутренние ссылки главной страницы ( 101 ) | |
commercials.htm | Old Barbie Commercials |
disclaimer.htm | Disclaimers |
search.htm | Search Site |
ponytail.htm | Ponytail Barbie |
bubblecut.htm | Bubblecut Barbie |
fashionqueen.htm | Fashion Queen Barbie |
swirl.htm | Swirl Ponytail Barbie |
missbarbie.htm | Miss Barbie |
americangirl.htm | American Girl Barbie |
colormagic.htm | Color Magic Barbie |
mod.htm | Mod - Twist 'n Turn (TNT) Barbie |
standardbarbie.htm | Mod - Standard Straight-Leg Barbie |
hair-fair.htm | Mod - Hair Fair Barbie (Head) |
talkingbarbie.htm | Mod - Talking Barbie |
livingbarbie.htm | Mod - Dramatic Living Barbie |
growinprettyhair.htm | Mod - Growin' Pretty Hair Barbie |
liveaction.htm | Mod - Live Action Barbie |
sunsetmalibubarbie.htm | Mod - Sunset Malibu Barbie |
hairhappenins.htm | Mod - Hair Happenin's Barbie |
busybarbie.htm | Mod - Busy Barbie |
walklively.htm | Mod - Walk Lively Barbie |
montgomerywardbarbie.htm | Montgomery Ward Reissue Ponytail Barbie |
quickcurl.htm | Quick Curl Barbie |
barbie1974-1976.htm | Barbie - The Later Years (1974-1977) |
foreign.htm | Foreign Dolls |
reproductions.htm | Vintage Reproduction Barbies (1994 - Current) |
silkstonebarbies.htm | Silkstone Barbies |
christmasbarbies.htm | Holiday Barbies |
allan.htm | Allan |
steffie.htm | Steffie |
brad.htm | Brad & Curtis |
tuttitoddchris.htm | Tutti |
cara.htm | Cara |
casey-twiggy.htm | Twiggy |
christie.htm | Christie |
fluff-tiff.htm | Tiff |
francie.htm | Francie (1966-1971) |
francie-1.htm | Francie (1972-1976) |
skipper-1.htm | Skipper (1972-1976) |
jamie.htm | Jamie |
julia.htm | Julia |
kelley.htm | Kelley |
ken1961-1967.htm | Ken (1961-1967) |
ken1969to1973.htm | Ken (1969-1976) |
midge.htm | Midge |
missamerica.htm | Miss America |
pj.htm | PJ |
ricky.htm | Ricky |
skipper.htm | Skipper (1964-1971) |
scooter.htm | Skooter |
stacey.htm | Stacey |
trulyscrumptious.htm | Truly Scrumptious |
accessories.htm | Barbie's Accessories |
fashion1959-1962.htm | Barbie's Fashions 1959-1962 |
fashion1963-1964.htm | Barbie's Fashions 1963-1964 |
fashion1965-1966.htm | Barbie's Fashions 1965-1966 |
barbiefashion1967-1968.htm | Barbie's Fashions 1967-1968 |
barbiefashion1969.htm | Barbie's Fashions 1969 |
barbiefashion1970.htm | Barbie's Fashions 1970 |
barbiefashion1971.htm | Barbie's Fashions 1971 |
barbiefashion1972.htm | Barbie's Fashions 1972 |
pak62-65.htm | Barbie's Fashion Pak 1962-1965 |
pak66-71.htm | Barbie's Fashion Pak 1966-1971 |
barbiegiftsets.htm | Barbie's Gift Sets |
franciefashion1966-1968.htm | Francie Size Fashions 1966-1968 |
franciefashion1969-1971.htm | Francie Size Fashions 1969-1971 |
franciefashion1972.htm | Francie Size Fashions 1972 |
francieskippergiftpakrickyfash.htm | Skipper Size Pak Items |
kenfashioin1961-1968.htm | Ken Size Fashions 1961-1968 |
kenfashion69-72pakgift61-72.htm | Ken's Gift Sets and Pak Items |
skipperfashioin1964-1968.htm | Skipper Size Fashions 1964-1968 |
skipperfashioin1969-1972.htm | Skipper Size Fashions 1969-1972 |
tuttisizefashion66-68.htm | Tutti Size Fashions 1966-1968 |
christmas.htm | A Barbie Christmas |
barbie-on-holiday.htm | Barbies Adventures |
bits-pieces.htm | Bits and Pieces |
buildingsandfurniture.htm | Buildings and Furniture |
christmasornaments.htm | Barbie Ornaments |
casesandlunchboxes.htm | Doll Cases and Lunch Boxes |
pets.htm | Pets and Animal Toys |
rare-dressed-dolls.htm | Sample and Dressed Dolls |
transportation.htm | Transportation |
barbie-for-kids.htm | Barbie's for Kids |
new-collector-dolls.htm | New Collector Barbies |
ourfavoritethings.htm | Our Favorite Things |
shop-vintage-reproductions.htm | Vintage Reproductions |
madamealexander.htm | Madame Alexander Dolls |
aboutthissite.htm | About This Site |
advertising.htm | Advertising |
user-questions.htm | FAQ and Not-So-FAQ |
privacypolicy.htm | Privacy Policy |
barbiebooks.htm | Fashion Booklets |
boxes.htm | Barbie Doll Boxes (Early Years) |
id.htm | Barbie Doll Identification |
releasedate.htm | Release Date Chart 1959-1972 |
controversy.htm | Controversy |
fashiontrends.htm | Fashion Trends |
barbiehistory.htm | History of Barbie |
labels-zippers-shoes.htm | Labels, Zippers and Shoe Markings |
prototype-ooak.htm | Prototype and Ooak Barbies |
trivia.htm | Trivia |
Domain Name: MYVINTAGEBARBIES.COM
Registry Domain ID: 1648555532_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.tucows.com
Registrar URL: http://www.tucowsdomains.com
Updated Date: 2018-03-03T05:59:22Z
Creation Date: 2011-04-01T00:45:53Z
Registry Expiry Date: 2019-04-01T00:45:53Z
Registrar: Tucows Domains Inc.
Registrar IANA ID: 69
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: YNS1.YAHOO.COM
Name Server: YNS2.YAHOO.COM
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2018-10-06T04:21:06Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar. Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.
TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.
The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.
Sitemap:http://myvintagebarbies.com/sitemap.xml
США - 161.225.130.163
Target Corporation
Target Corporation
HTTP/1.1 200 OK
Date: Thu, 07 Nov 2019 02:57:14 GMT
P3P: policyref="https://policies.yahoo.com/w3c/p3p.xml", CP="CAO DSP COR CUR ADM DEV TAI PSA PSD IVAi IVDi CONi TELo OTPi OUR DELi SAMi OTRi UNRi PUBi IND PHY ONL UNI PUR FIN COM NAV INT DEM CNT STA POL HEA PRE LOC GOV"
X-Host: p8w69.geo.gq1.yahoo.com
X-INKT-URI: http://www.myvintagebarbies.com//kmroyer2002/us3/index.html
X-INKT-SITE: http://www.myvintagebarbies.com
Last-Modified: Fri, 22 Mar 2019 18:24:58 GMT
Accept-Ranges: bytes
Content-Length: 29404
Vary: Accept-Encoding
Content-Type: text/html
Age: 0
Connection: keep-alive
Server: ATS/7.1.2
Кнопка для анализа сайта в один клик, для установки перетащите ссылку на "Панель закладок"