Возраст домена | 17 лет |
Дата окончания | Истек срок регистрации |
PR | 3 |
ИКС | n/a |
Страниц в Google | 52 |
Страниц в Яндексе | 32 |
Dmoz | Нет |
Яндекс Каталог | Нет |
Alexa Traffic Rank | 18681539 |
Alexa Country | Нет данных |
История изменения показателей | Авторизация |
Идет сбор информации... Обновить
Pickaway County Family & Children First - Welcome
n/a
n/a
UTF-8
34.68 КБ
399
3 083 симв.
2 620 симв.
Данные предоставлены сервисом semrush
Сайт | Общие фразы | PR | тИЦ | Alexa Rank | Alexa Country | |
---|---|---|---|---|---|---|
![]() |
13 | 3 |
0 | 15577049 | ![]() |
|
![]() ![]() |
11 | 7 |
0 | 6422 | ![]() | |
![]() ![]() |
7 | 4 |
0 | 5909292 | ![]() |
|
![]() |
5 | 4 |
0 | 10705431 | ![]() |
|
![]() ![]() |
4 | 4 |
0 | 5638674 | ![]() | |
![]() |
4 | 8 |
0 | 62127 | ![]() | |
![]() ![]() |
3 | 7 |
0 | 4520 | ![]() | |
![]() ![]() |
2 | 5 |
0 | 99084 | ![]() | |
![]() ![]() |
2 | 8 |
0 | 3182 | ![]() | |
![]() ![]() |
2 | 9 |
0 | 3 | ![]() | |
Еще 40 сайтов после авторизации |
Данные предоставлены сервисом semrush
Счетчик | Посетители за 24 часа | Просмотры | Просмотров на посетителя |
---|---|---|---|
![]() | Нет доступа | Нет доступа | n/a |
Данные linkpad ( 4 Марта 2013 ) | |
Количество ссылок на сайт | 6 |
Количество доменов, которые ссылаются на сайт | 6 |
Количество найденных анкоров | 6 |
Исходящие (внешние) ссылки домена | 88 |
Количество доменов, на которые ссылается сайт | 47 |
Количество исходящих анкоров | 61 |
Внешние ссылки главной страницы ( 2 ) | |
facebook.com/profile.php?id=100008818695996 | - |
weebly.com/signup?utm_source=internal&utm_medium=footer | Powered by Create your own unique website with customizable templates. Get Started |
Внутренние ссылки главной страницы ( 33 ) | |
/ | FCFC 101 SITE-MAP |
/ohio-fcf.html | Ohio FCF |
/who-we-are.html | Who We Are |
/fcfc-council-meetings.html | FCFC Council Meetings > |
/council-meeting-minutes.html | Council Meeting Minutes |
/structure--membership.html | Structure & Membership > |
/organizational-structure.html | Organizational Structure |
/by-laws.html | BY-LAWS |
/membership.html | Membership > |
/mandated-members-per-the-orc-12137.html | Mandated Members per the ORC 121.37 |
/council-committees.html | Council Committees > |
/standing-committees.html | Standing Committees |
/fcfc-funding.html | FCFC Funding > |
/fcfc-grants-information.html | FCFC Grants information |
/donated-funds.html | Donated Funds |
/programs.html | Programs |
/resources.html | Resources |
/acronyms.html | Acronyms |
/resource-directory.html | Resource Directory |
/county-calendarsfamily-activities.html | County Calendars/Family Activities |
/help-me-grow.html | Help Me Grow |
/team.html | TEAM |
/team-forms.html | TEAM Forms |
/parent-education-classes.html | Parent Education Classes |
/parents.html | Parents |
/pickaway-parenting-cafe.html | Pickaway Parenting Cafe |
/parent-advisory-committee.html | Parent Advisory Committee |
/support-groups.html | Support Groups |
/resource-links.html | Resource Links |
/contacts.html | Contacts |
/connections.html | CONNECTIONS |
/early-childhood-collaborative-committee.html | Early Childhood Collaborative Committee |
/teen-task-force.html | Teen Task Force |
[Querying whois.publicinterestregistry.net]
[whois.publicinterestregistry.net]
Access to .ORG WHOIS information is provided to assist persons in
determining the contents of a domain name registration record in the
Public Interest Registry registry database. The data in this record is provided by
Public Interest Registry for informational purposes only, and Public Interest Registry does not
guarantee its accuracy. This service is intended only for query-based
access. You agree that you will use this data only for lawful purposes
and that, under no circumstances will you use this data to: (a) allow,
enable, or otherwise support the transmission by e-mail, telephone, or
facsimile of mass unsolicited, commercial advertising or solicitations
to entities other than the data recipient's own existing customers; or
(b) enable high volume, automated, electronic processes that send
queries or data to the systems of Registry Operator, a Registrar, or
Afilias except as reasonably necessary to register domain names or
modify existing registrations. All rights reserved. Public Interest Registry reserves
the right to modify these terms at any time. By submitting this query,
you agree to abide by this policy.
Domain ID:D148165740-LROR
Domain Name:PICKAWAYFAMILYANDCHILDRENFIRST.ORG
Created On:19-Jun-2007 13:20:11 UTC
Last Updated On:15-Apr-2013 15:51:11 UTC
Expiration Date:19-Jun-2014 13:20:11 UTC
Sponsoring Registrar:GoDaddy.com, LLC (R91-LROR)
Status:CLIENT DELETE PROHIBITED
Status:CLIENT RENEW PROHIBITED
Status:CLIENT TRANSFER PROHIBITED
Status:CLIENT UPDATE PROHIBITED
Registrant ID:CR33471600
Registrant Name:Todd Tomlinson
Registrant Street1:348 Ludwig Dr
Registrant Street2:
Registrant Street3:
Registrant City:Circleville
Registrant State/Province:Ohio
Registrant Postal Code:43113
Registrant Country:US
Registrant Phone:+1.7404776066
Registrant Phone Ext.:
Registrant FAX:
Registrant FAX Ext.:
Registrant Email:ttomlinson@columbus.rr.com
Admin ID:CR33471602
Admin Name:Todd Tomlinson
Admin Street1:348 Ludwig Dr
Admin Street2:
Admin Street3:
Admin City:Circleville
Admin State/Province:Ohio
Admin Postal Code:43113
Admin Country:US
Admin Phone:+1.7404776066
Admin Phone Ext.:
Admin FAX:
Admin FAX Ext.:
Admin Email:ttomlinson@columbus.rr.com
Tech ID:CR33471601
Tech Name:Todd Tomlinson
Tech Street1:348 Ludwig Dr
Tech Street2:
Tech Street3:
Tech City:Circleville
Tech State/Province:Ohio
Tech Postal Code:43113
Tech Country:US
Tech Phone:+1.7404776066
Tech Phone Ext.:
Tech FAX:
Tech FAX Ext.:
Tech Email:ttomlinson@columbus.rr.com
Name Server:NS11.DOMAINCONTROL.COM
Name Server:NS12.DOMAINCONTROL.COM
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
DNSSEC:Unsigned
Sitemap: http://www.pickawayfamilyandchildrenfirst.org/sitemap.xml
User-agent: NerdyBot
Disallow: /
User-agent: *
Disallow: /ajax/
Disallow: /apps/
США - Prineville - 66.220.149.88
США - 66.220.152.16
США - 66.220.158.70
США - Хиллсборо - 69.171.234.21
США - 69.171.237.16
США - 69.171.247.21
HTTP/1.1 200 OK
Date: Tue, 18 Jun 2019 03:57:21 GMT
Server: Apache
Set-Cookie: is_mobile=0; path=/; domain=www.pickawayfamilyandchildrenfirst.org
Vary: X-W-SSL,Accept-Encoding,User-Agent
Set-Cookie: language=en; expires=Tue, 02-Jul-2019 03:57:21 GMT; Max-Age=1209600; path=/
Set-Cookie: gdpr-kb=1; expires=Fri, 15-Jun-2029 03:57:21 GMT; Max-Age=315360000; path=/
Cache-Control: private
ETag: W/"66f2b59711690338edc2459ba3f215a8"
X-Host: pages28.sf2p.intern.weebly.net
X-UA-Compatible: IE=edge,chrome=1
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
Кнопка для анализа сайта в один клик, для установки перетащите ссылку на "Панель закладок"