Возраст домена | 9 лет |
Дата окончания | Истек срок регистрации |
ИКС | |
Страниц в Google | 11 |
Страниц в Яндексе | 4 |
Dmoz | Нет |
Яндекс Каталог | Нет |
Alexa Traffic Rank | 15419368 |
Alexa Country | Нет данных |
История изменения показателей | Авторизация |
Идет сбор информации... Обновить
Primary Care Walk-in Medical Clinic: Primary Care: Gilbert, AZ & Fountain Hills, AZ
n/a
Trusted Primary Care serving Gilbert, AZ & Fountain Hills, AZ. Visit our website to book an appointment online: Primary Care Walk-in Medical Clinic
UTF-8
396.75 КБ
750
5 585 симв.
4 700 симв.
Идет сбор информации... Обновить
Идет сбор информации... Обновить
Счетчик | Посетители за 24 часа | Просмотры | Просмотров на посетителя |
---|---|---|---|
Google Analytics | Нет доступа | Нет доступа | n/a |
Внешние ссылки главной страницы ( 8 ) | |
sa1s3.patientpop.com/assets/docs/101380.pdf | Patient Forms |
goo.gl/maps/U1yW1ZJ7MFT4bdyW6 | "Dr. Mashewhari and her staff are amazing. We have used her services for years." |
goo.gl/maps/WRJUB2WCbMjYkEf78 | "Dr. Neha Maheshwari and her staff are very professional, friendly & extremely competent." |
goo.gl/maps/eFCZqNzK8pevAwUc7 | "Always received excellent care here. Would recommend to anyone." |
goo.gl/maps/3hj9gbaKuVzvFkKv7 | "The providers always address all of my questions and treat me appropriately every visit." |
goo.gl/maps/PLomLz1R6pMuV7mR9 | "Doctor M is so intelligent and up to date on all issues. She takes a personal interest." |
facebook.com/Primary-Care-Walk-In-Medical-Clinic-50150953671... | - |
twitter.com/care_walk | - |
Внутренние ссылки главной страницы ( 37 ) | |
/ | Home |
/about | About Practice |
/provider | Providers |
/services | Services |
/services/botoxfillers | Botox/Fillers more info |
/services/hormone-therapy | Hormone Therapy more info |
/services/geriatric-services | Geriatric Services more info |
/services/physicals-all-ages | Physicals - All Ages more info |
/services/immunizations | Immunizations more info |
/services/stds | STDs more info |
/services/respiratory-issues | Respiratory Issues more info |
/services/walk-in-clinic | Walk In Clinic more info |
primarycarewalkinmedicalclinic.com/services | View More Services |
/blog | Blog |
/testimonials | Testimonials |
/contactus | Call Us |
/services/chronic-disease-management | Chronic Disease Management more info |
/services/allergy-testing | Allergy Testing more info |
/services/migraines | Migraines more info |
/services/sore-throat | Sore Throat more info |
/services/flu | Flu more info |
/services/uti | UTI more info |
/services/fever | Fever more info |
/services/minor-injuries | Minor Injuries more info |
primarycarewalkinmedicalclinic.com/provider/pankaj-chopra-md | Pankaj Chopra, MD Board Certified Family Medicine |
primarycarewalkinmedicalclinic.com/provider/neha-maheshwari-... | Neha Maheshwari, MD Board Certified Family Medicine |
primarycarewalkinmedicalclinic.com/provider/sufia-khan-md | Sufia Khan, MD Board Certified Family Medicine |
primarycarewalkinmedicalclinic.com/provider/stephanie-niepok... | Stephanie Niepokoj-Dunn, FNP-C Nurse Practitioner |
primarycarewalkinmedicalclinic.com/provider/ericka-vaughn-fn... | Ericka Vaughn, FNP-C Nurse Practitioner |
primarycarewalkinmedicalclinic.com/blog/botox-a-quick-and-ef... | Botox: A Quick and Effective Holiday Pick-Me-Up |
primarycarewalkinmedicalclinic.com/blog/who-needs-an-std-tes... | Who Needs an STD Test and How Often? |
primarycarewalkinmedicalclinic.com/blog/why-you-need-a-flu-s... | Why You Need a Flu Shot Every Year |
/location/az/gilbert | 2721 S Santan Village Parkway Ste 104, Gilbert, AZ 85295 |
/location/az/fountain-hills | 16605 E. Palisades Blvd Ste 150, Fountain Hills, AZ 85268 |
primarycarewalkinmedicalclinic.com/your-privacy nofollow | Privacy Policy |
primarycarewalkinmedicalclinic.com/our-terms nofollow | Terms & Conditions |
primarycarewalkinmedicalclinic.com/contactus | Contact Us |
Domain names in the .com and .net domains can now be registered
with many different competing registrars. Go to http://www.internic.net
for detailed information.
Domain Name: PRIMARYCAREWALKINMEDICALCLINIC.COM
Registrar: TUCOWS DOMAINS INC.
Sponsoring Registrar IANA ID: 69
Whois Server: whois.tucows.com
Referral URL: http://www.tucowsdomains.com
Name Server: NS1.IPAGE.COM
Name Server: NS2.IPAGE.COM
Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Updated Date: 05-jul-2016
Creation Date: 20-jul-2014
Expiration Date: 20-jul-2017
>>> Last update of whois database: Wed, 28 Sep 2016 19:36:57 GMT <<<
For more information on Whois status codes, please visit https://icann.org/epp
NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar. Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.
TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.
The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.
Maximum Daily connection limit reached. Lookup refused.
User-agent: *
Disallow: /landing/
США - 66.96.149.1
The Endurance International Group
The Endurance International Group
HTTP/1.1 200 OK
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Date: Wed, 04 Dec 2019 13:25:12 GMT
Server: nginx/1.14.1
X-UA-Compatible: IE=edge,chrome=1
Cache-Control: max-age=3600, public
X-Cache: Miss from cloudfront
Via: 1.1 f8558580f66929e19ed69bba2e85da75.cloudfront.net (CloudFront)
X-Amz-Cf-Pop: IAD79-C1
X-Amz-Cf-Id: KXrHeXv5h3uZJWoWNheQ5McYmN_rdBqKlMU5JdSjdvTLoMrg6dYPHQ==
Кнопка для анализа сайта в один клик, для установки перетащите ссылку на "Панель закладок"