Возраст домена | 18 лет |
Дата окончания | Истек срок регистрации |
PR | 3 |
ИКС | n/a |
Страниц в Google | 423 |
Страниц в Яндексе | 18 |
Dmoz | Нет |
Яндекс Каталог | Нет |
Alexa Traffic Rank | 8407126 |
Alexa Country | Нет данных |
История изменения показателей | Авторизация |
Идет сбор информации... Обновить
Veterans Benefits Claims | Sean Kendall
n/a
A lawyer for veterans benefits claims. Unemployability claims, PTSD, traumatic brain injury, physical disabilities.
UTF-8
125.27 КБ
1 054
7 690 симв.
6 414 симв.
Данные предоставлены сервисом semrush
Сайт | Общие фразы | PR | тИЦ | Alexa Rank | Alexa Country | |
---|---|---|---|---|---|---|
![]() ![]() |
13 | 2 |
0 | 15535241 | ![]() |
|
![]() |
10 | 3 |
0 | 21227474 | ![]() |
|
![]() ![]() |
7 | 3 |
0 | 305670 | ![]() | |
![]() |
5 | n/a | 0 | Нет данных | ![]() |
|
![]() |
4 | n/a | 0 | 10208386 | ![]() |
|
![]() |
3 | 1 |
0 | 8998130 | ![]() |
|
![]() |
3 | 3 |
0 | 14017523 | ![]() |
|
![]() |
3 | n/a | 0 | Нет данных | ![]() |
|
![]() |
2 | 5 |
0 | 5941066 | ![]() |
|
![]() ![]() |
1 | 1 |
0 | 7819427 | ![]() | |
Еще 40 сайтов после авторизации |
Данные предоставлены сервисом semrush
Счетчик | Посетители за 24 часа | Просмотры | Просмотров на посетителя |
---|---|---|---|
![]() | Нет доступа | Нет доступа | n/a |
Данные linkpad ( 9 Февраля 2015 ) | |
Количество ссылок на сайт | 5 |
Количество доменов, которые ссылаются на сайт | 5 |
Количество найденных анкоров | 4 |
Исходящие (внешние) ссылки домена | 608 |
Количество доменов, на которые ссылается сайт | 70 |
Количество исходящих анкоров | 88 |
Внешние ссылки главной страницы ( 6 ) | |
facebook.com/pages/Sean-Kendall-Attorney-at-Law-Veterans-Cla... | - |
twitter.com/vetsrightslaw | - |
linkedin.com/pub/sean-kendall/6/770/191 | - |
google.com/maps/dir//Kendall+Sean+A,+2727+Pine+St+%236,+Boul... | Get Directions |
fosterwebmarketing.com/reports/attract-more-of-your-best-cli... nofollow | Dynamic Self-Syndication (DSS™) |
dss.fosterwebmarketing.com nofollow | DSS Login |
Внутренние ссылки главной страницы ( 39 ) | |
/ | Home |
/feed.xml | - |
/practice_areas/ | Types of Cases We Accept |
/practice_areas/unemployability.cfm | Unemployability Claims for Veterans (TDIU) Learn More |
/practice_areas/post-traumatic-stress-disorder.cfm | PTSD Claims Learn More |
/practice_areas/court-of-appeals-for-veterans-claims.cfm | Court of Appeals for Veterans Claims Learn More |
/practice_areas/physical-disabilities.cfm | Physical Disabilities Learn More |
/practice_areas/agent-orange.cfm | Agent Orange Learn More |
/practice_areas/traumatic-brain-injury.cfm | Traumatic Brain Injury Learn More |
/practice_areas/gulf-war-syndrome.cfm | Gulf War Syndrome Learn More |
/practice_areas/survivors-and-dependents.cfm | Survivors and Dependents Learn More |
/practice_areas/veterans-affairs-lawyer-obtain-your-veterans... | Veterans Affairs Learn More |
/bio.cfm | See all Members |
/aboutus.cfm | About Our Firm |
/bio/timothy-franklin.cfm | Timothy R. Franklin Attorney |
/bio/sean-kendall.cfm | Sean Kendall Veteran's Attorney |
/bio/seankendallparalegaladamperry.cfm | Adam M. Perry Certified Paralegal |
/testimonials.cfm | View more from our clients |
/case-results.cfm | Results |
/faq.cfm | FAQs |
/library/ | Articles |
/news.cfm | Read All News |
/resources.cfm | Resources |
/video/ | Helpful Videos |
/reports/ | Free Offer |
/blog/ | Read All Blog |
/contact.cfm | Contact Us |
/blog/how-ptsd-can-lead-to-migraines.cfm | How PTSD Can Lead to Migraines |
/blog/dealing-with-missing-medical-records.cfm | Dealing With Missing Medical Records |
/blog/understanding-the-lasting-effects-of-agent-orange.cfm | Understanding the Lasting Effects of Agent Orange |
/news/blue-water-veterans-january-1-2020.cfm | Blue Water Veterans January 1, 2020 |
/news/class-action-filed-against-va.cfm | Class Action Filed Against VA |
/news/new-va-appeals-process-starts-february-19-2019.cfm | New VA Appeals Process Starts February 19, 2019 |
/testimonials/george-wins-service-connection-for-ptsd-.cfm | As a Vietnam Veteran, the battle to prove service-connection for PTSD and prove a 100 percent unemployability rating. |
/testimonials/victor-wins-tdiu-glad-he-hired-law-office-of-s... | Veteran Wins TDIU, Glad He Hired Law Office of Sean Kendall |
/testimonials/veteran-wins-tdiu-claim-with-sheltered-employm... | TDIU Benefit granted to sheltered employee. |
/reports/veterans-benefits-handbook-second-edition.cfm | Learn More |
/privacy.cfm | Privacy Policy |
/sitemap.cfm | Site Map |
Domain Name: SEANKENDALLLAW.NET
Registry Domain ID: 429483592_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Update Date: 2015-04-24T12:46:22Z
Creation Date: 2006-04-28T14:42:54Z
Registrar Registration Expiration Date: 2018-04-28T14:42:54Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Ann Marie Weinert
Registrant Organization:
Registrant Street: PO Box 301
Registrant City: Bensenville
Registrant State/Province: Illinois
Registrant Postal Code: 60106
Registrant Country: US
Registrant Phone: (847) 981-0831
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: annmarieweinert@hotmail.com
Registry Admin ID: Not Available From Registry
Admin Name: Ann Marie Weinert
Admin Organization:
Admin Street: PO Box 301
Admin City: Bensenville
Admin State/Province: Illinois
Admin Postal Code: 60106
Admin Country: US
Admin Phone: (847) 981-0831
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: annmarieweinert@hotmail.com
Registry Tech ID: Not Available From Registry
Tech Name: Ann Marie Weinert
Tech Organization:
Tech Street: PO Box 301
Tech City: Bensenville
Tech State/Province: Illinois
Tech Postal Code: 60106
Tech Country: US
Tech Phone: (847) 981-0831
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: annmarieweinert@hotmail.com
Name Server: ANIRBAN.NS.CLOUDFLARE.COM
Name Server: ELMA.NS.CLOUDFLARE.COM
>>> Last update of WHOIS database: 2016-03-21T06:00:00Z <<<
For more information on Whois status codes, please visit https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en
User-agent: *
Disallow: /*sessionStorage$
Disallow: /*memoryStorage$
Disallow: /*localStorage$
Disallow: /*cookieStorage$
Disallow: /*util$
Disallow: /*store-engine$
Disallow: /includes/service
Disallow: /includes/mobile/layout-switch.cfm
Disallow: /auto-advance
Disallow: /playlist-maker
Disallow: /play-item
Sitemap: https://www.seankendalllaw.net/sitemap.xml
HTTP/1.1 200 OK
Date: Tue, 28 Jan 2020 22:40:23 GMT
Content-Type: text/html;charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Set-Cookie: __cfduid=d9a692dae10c1cb43fd8e9336ff1646941580251223; expires=Thu, 27-Feb-20 22:40:23 GMT; path=/; domain=.seankendalllaw.net; HttpOnly; SameSite=Lax; Secure
Vary: Accept-Encoding
Set-Cookie: CFID=Z1h3s0bo6pyosu1jklxd4uhdms51dbmgs1wkbsirxexgop7pqda-40762475; Domain=.seankendalllaw.net; Expires=Thu, 20-Jan-2050 22:40:31 GMT; Path=/; HttpOnly
Set-Cookie: CFTOKEN=Z1h3s0bo6pyosu1jklxd4uhdms51dbmgs1wkbsirxexgop7pqda-f179a123c7fae062-4F250C4D-995C-3D0C-ACABC7BC8962275A; Domain=.seankendalllaw.net; Expires=Thu, 20-Jan-2050 22:40:31 GMT; Path=/; HttpOnly
Set-Cookie: ONSERVER=117%2DC; Path=/
Set-Cookie: EX_HTTP_REFERER=http%3A%2F%2Fprlog%2Eru%2Fanalysis%2Fseankendalllaw%2Enet; Path=/
Set-Cookie: ENTRY_TEMPLATE=www%2Eseankendalllaw%2Enet%2F; Path=/
X-Powered-By: DSS
Access-Control-Allow-Origin: *
CF-Cache-Status: DYNAMIC
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Server: cloudflare
CF-RAY: 55c677c3c987f21a-ORD
Кнопка для анализа сайта в один клик, для установки перетащите ссылку на "Панель закладок"