Возраст домена | 10 лет |
Дата окончания | Истек срок регистрации |
PR | 4 |
ИКС | 0 |
Страниц в Google | 1780 |
Страниц в Яндексе | 651 |
Dmoz | Нет |
Яндекс Каталог | Нет |
Alexa Traffic Rank | 4714435 |
Alexa Country | Нет данных |
История изменения показателей | Авторизация |
Идет сбор информации... Обновить
FREE LOVE SPELLS THAT WORK - VOODOO LOVE SPELLS BLACK MAGIC SPELLS magic spells wiccan white spells
love spells, free spells, voodoo spells, black magic spells, white magic spells, magic spells, wicca spells, wiccan spells, free love spells, easy love spells, spells
SPELL 4 FREE: THE MAGICK PLACE TO BE! Powerful spells cast by me for free. Choose between many types: Free Love spells Free easy spells spell casters wiccan to voodoo love spells powerful guaranteed free white magick spells and black magic spells or wicca
WINDOWS-1252
19.87 КБ
1 277
8 651 симв.
7 084 симв.
Данные предоставлены сервисом semrush
Сайт | Общие фразы | PR | тИЦ | Alexa Rank | Alexa Country | |
---|---|---|---|---|---|---|
![]() ![]() |
58 | 9 |
0 | 2 | ![]() | |
![]() |
51 | 2 |
0 | 310948 | ![]() | |
![]() ![]() |
47 | 4 |
0 | 142675 | ![]() | |
![]() ![]() |
43 | 5 |
10 | 256251 | ![]() | |
![]() ![]() |
34 | 3 |
0 | 1526860 | ![]() |
|
![]() |
32 | n/a | 0 | 11620021 | ![]() |
|
![]() ![]() |
31 | 4 |
0 | 6469728 | ![]() |
|
![]() ![]() |
28 | 8 |
0 | 175 | ![]() | |
![]() |
27 | 3 |
0 | 3121826 | ![]() |
|
![]() ![]() |
24 | 4 |
0 | 13995039 | ![]() |
|
![]() ![]() |
1 | 9 |
0 | 1 | ![]() | |
![]() |
1 | 1 |
0 | 371752 | ![]() | |
![]() |
1 | 1 |
0 | 15610044 | ![]() |
|
![]() ![]() |
1 | 9 |
0 | 3 | ![]() | |
![]() |
1 | 3 |
0 | 939607 | ![]() | |
![]() ![]() |
1 | 3 |
0 | 1224034 | ![]() | |
![]() ![]() |
1 | 9 |
0 | 59 | ![]() | |
Еще 33 сайта после авторизации |
Данные предоставлены сервисом semrush
Данные linkpad ( 17 Октября 2016 ) | |
Количество ссылок на сайт | 4878 |
Количество доменов, которые ссылаются на сайт | 491 |
Количество найденных анкоров | 199 |
Исходящие (внешние) ссылки домена | 4868 |
Количество доменов, на которые ссылается сайт | 62 |
Количество исходящих анкоров | 50 |
Внешние ссылки главной страницы ( 6 ) | |
powerfulblackmagicspells.com | powerfulblackmagicspells.com |
witchcraftspells.online | www.witchcraftspells.online |
voodooandspells.com | www.voodooandspells.com |
animalreadings.info | Free READINGS |
facebook.com/PowerfulFullMoon | Full moon page |
facebook.com/LuckCalculator | Luck Calculator |
Внутренние ссылки главной страницы ( 49 ) | |
Www.spells4free.net | spells |
freespellscast.html | FREE SPELLS |
bestlovepsychicspellscastersreviews.html | real and honest spell casters |
/freelovespellsblog | READ MY BLOG |
freelovespellsmailinglist.html | Free powerful Love Spell |
<img> | |
../White-Magic-Love-Spells/ | White Magic Love Spells |
../Money-Spells/ | Money Spells |
../Protection-Spells/ | Protection Spells |
../Beauty-Spells/ | Beauty Spells |
../freespellscast.html | free spells |
../voodoospells.html | Voodoo Spells |
../Hoodoo-Spells/ | Hoodoo Spells |
../White-Magic-Spells/ | White Magic Spells |
../Black-Magic/ | Black Magic |
../Wicca-Spells/ | Wicca Spells |
/freelovespellsblog/ | READ MY BLOG |
wishingwell.php | READ MORE AND POST YOUR OWN WISH |
../Wishing-Well/ | Wishing Well |
../Alternative-Medicines/ | Alternative Medicines |
../Egyptian-Amulets/ | Egyptian Amulets |
../Angels/ | Angels |
../Article/ | Articles |
../Articles-Not-About-Spells-Or-Magick/ | Articles not about Spells or Magick |
../Astral-Projection | Astral Projection |
../Black-Magic-Love-Spells/ | Black Magic Love Spells |
../Feng-Shui/ | Feng Shui |
../Healing-Spells/ | Healing Spells |
../Hypnosis/ | Hypnosis |
../Law-of-Attraction/ | Law of Attraction |
../Prayers/ | Prayers |
../Voodoo-Love-Spells/ | Voodoo Love Spells |
../Candle-Spells/ | Candle Spells |
voodoospells.html | Voodoo Spells |
../White-Magic-Love-Spells/Spell-to-Bring-Someone-Closer.htm... | Spell to Bring Someone Closer |
../White-Magic-Love-Spells/Make-Him-Love-You.html | Make Him Love You |
luckcalculator.html | Check your LUCK |
onlinetarotcardsreadings.html | Tarot Card Readings |
freedailyhoroscopes | Free Daily Horoscope |
zodiac-love-compatibility.html | Love Compatibility |
datingtipsandlovespells.html | Dating Tips |
fullmoon.html | Full Moon |
magickstones.html | Magick Stones |
lovespellsthatwork.html | Love Spells That Work |
populararticles.html | Most Popular Spells |
linkus.html | Links and Link Exchange |
submitguidelines.html | Submission Guidelines |
privacy.html | Privacy Policy |
terms.html | Terms of Service |
Domain Name: SPELLS4FREE.NET
Registry Domain ID: 1822312390_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 2018-08-07T22:28:02Z
Creation Date: 2013-08-18T17:48:54Z
Registry Expiry Date: 2019-08-18T17:48:54Z
Registrar: NameCheap, Inc.
Registrar IANA ID: 1068
Registrar Abuse Contact Email: abuse@namecheap.com
Registrar Abuse Contact Phone: +1.6613102107
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.WEBSITEHOSTSERVER.NET
Name Server: NS2.WEBSITEHOSTSERVER.NET
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2018-12-13T14:31:45Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar. Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.
TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.
The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.
User-agent: *
Crawl-delay: 10
User-agent: *
Disallow: /profile/
США - 17.149.160.49
США - 17.172.224.47
Apple
Apple
HTTP/1.1 200 OK
Connection: Keep-Alive
Content-Type: text/html
Last-Modified: Tue, 11 Dec 2018 23:59:16 GMT
Etag: "05c104f54-0;;;"
Accept-Ranges: bytes
Content-Length: 20347
Date: Mon, 02 Dec 2019 19:05:12 GMT
Strict-Transport-Security: max-age=63072000; includeSubDomains
X-Frame-Options: SAMEORIGIN
X-Content-Type-Options: nosniff
Vary: User-Agent
Cache-Control: max-age=3600, must-revalidate
Alt-Svc: quic=":443"; ma=2592000; v="39,43,46", h3-Q039=":443"; ma=2592000, h3-Q043=":443"; ma=2592000, h3-Q046=":443"; ma=2592000, h3-23=":443"; ma=2592000, h3-24=":443"; ma=2592000
Кнопка для анализа сайта в один клик, для установки перетащите ссылку на "Панель закладок"