Возраст домена | 14 лет |
Дата окончания | Истек срок регистрации |
PR | 3 |
ИКС | |
Страниц в Google | 88 |
Страниц в Яндексе | 35 |
Dmoz | Нет |
Яндекс Каталог | Нет |
Alexa Traffic Rank | Нет данных |
Alexa Country | Нет данных |
История изменения показателей | Авторизация |
Идет сбор информации... Обновить
Welcome to Vidyamandir - Educate-Enlighten-Empower
n/a
n/a
ISO-8859-1
41.66 КБ
434
3 256 симв.
2 744 симв.
Данные предоставлены сервисом semrush
Сайт | Общие фразы | PR | тИЦ | Alexa Rank | Alexa Country | |
---|---|---|---|---|---|---|
![]() ![]() |
19 | 9 |
0 | 2 | ![]() | |
![]() |
13 | 2 |
0 | 12416473 | ![]() |
|
![]() ![]() |
12 | 9 |
0 | 3 | ![]() | |
![]() ![]() |
11 | 5 |
0 | 346890 | ![]() | |
![]() ![]() |
9 | 9 |
0 | 5 | ![]() | |
![]() ![]() |
8 | 7 |
0 | 1198 | ![]() | |
![]() |
8 | 5 |
0 | 734 | ![]() | |
![]() ![]() |
8 | 9 |
0 | 1 | ![]() | |
![]() ![]() |
7 | 6 |
0 | 3900 | ![]() | |
![]() ![]() |
7 | 3 |
0 | 4324364 | ![]() |
|
Еще 40 сайтов после авторизации |
Данные предоставлены сервисом semrush
Счетчик | Посетители за 24 часа | Просмотры | Просмотров на посетителя |
---|---|---|---|
![]() | Нет доступа | Нет доступа | n/a |
Данные linkpad ( 23 Апреля 2015 ) | |
Количество ссылок на сайт | 20 |
Количество доменов, которые ссылаются на сайт | 8 |
Количество найденных анкоров | 9 |
Исходящие (внешние) ссылки домена | 104 |
Количество доменов, на которые ссылается сайт | 4 |
Количество исходящих анкоров | 5 |
Внешние ссылки главной страницы ( 1 ) | |
facebook.com/SKMVM | <img> |
Внутренние ссылки главной страницы ( 60 ) | |
home.php | Home |
about_us.php | About Vidya Mandir |
values.php | Values and philosophy |
vision.php | Vision & Mission |
heritage.php | Our Heritage |
management.php | Management |
staff.php | Teaching Faculty and Administrative Staff |
sri_trust.php | Sri Kanchi Mahaswami Trust |
our_flag.php | Our Flag |
our_anthem.php | Our Anthem |
overview_eligibility.php | <img> |
adpolicy.php | Admission Policy |
prospectus.php | Application Form and Prospectus |
feestructure.php | Fee Structure |
conduct_policies.php | Code of Conduct and Policies |
moreinfo.php | More Information about Admission |
holistic.php | <img> |
vidya_mandir.php | Vidya Mandir |
curriculum.php | Curriculum |
person_devp.php | Personality Development |
career_coun.php | Career Counseling |
calendar.php | School Calendar |
opportunities.php | Opportunities Ahead |
facilities_overview.php | <img> |
sports_center.php | <img> |
art_zone.php | <img> |
library.php | <img> |
music_school.php | <img> |
dining_hall.php | <img> |
meditation_hall_recreation_center.php | <img> |
medical_center.php | <img> |
laboratories.php | <img> |
mahaswami_museum.php | <img> |
donation_overview.php | Donation Overview |
a_dollar_a_day.php | A Dollar a day |
Fund_a_Student.php | Fund a Student |
donations_towards_feeding.php | Donations towards Feeding |
donation_through_cheques_drafts.php | Donation through Cheques and Drafts |
membership_corpus_fund.php | Membership & corpus fund |
faqs.php | FAQ’s |
contact_us.php | Contact Us |
pdf/pension_application2019.pdf | Click here to view |
pdf/Bhikshavandanam 2018b.pdf | Click here to view |
images/pdf/annadhanam.pdf | Click here to view |
pdf/Sri Kanchi Mahaswami Annual report for Web 17-18.pdf | Click here to view |
sankara_card.php | Sankara Card |
video.php | More » |
overview_participate.php | How Can You Participate |
child_study.php | Send Your Child to Study |
sponsor.php | Sponsor a Child for a Year |
volunteer_work.php | Volunteer Work |
vedic_camp.php | Participation in the Vedic Camp |
pdf/L. M. Singhvi invitation.pdf | Click here for more |
pdf/launch of nursery school.pdf | Click here for more |
available_books_purchase.php | DVD’s present in the library |
curricular_activities.php | Events & Activities |
photogallery.php | Photo Gallery |
residential_campus.php | The Residential Campus |
# | <img> |
sitemap.php | Site Map |
Domain Name:SRIKANCHIMAHASWAMIVIDYAMANDIR.ORG
Domain ID: D159005044-LROR
Creation Date: 2010-04-28T11:56:57Z
Updated Date: 2013-02-28T07:46:55Z
Registry Expiry Date: 2018-04-28T11:56:57Z
Sponsoring Registrar:GoDaddy.com, LLC (R91-LROR)
Sponsoring Registrar IANA ID: 146
WHOIS Server:
Referral URL:
Domain Status: clientDeleteProhibited -- http://www.icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited -- http://www.icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited -- http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited -- http://www.icann.org/epp#clientUpdateProhibited
Registrant ID:CR46642311
Registrant Name:Shankar V
Registrant Organization:Sri Kanchi Mahaswami Trust
Registrant Street: Sion Road, Sion West
Registrant Street: 1 & 4, Kailas Bhavan, Plot 258
Registrant City:Mumbai
Registrant State/Province:Maharashtra
Registrant Postal Code:400022
Registrant Country:IN
Registrant Phone:+91.02224044006
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email:siesvs@gmail.com
Admin ID:CR46642315
Admin Name:Shankar V
Admin Organization:Sri Kanchi Mahaswami Trust
Admin Street: Sion Road, Sion West
Admin Street: 1 & 4, Kailas Bhavan, Plot 258
Admin City:Mumbai
Admin State/Province:Maharashtra
Admin Postal Code:400022
Admin Country:IN
Admin Phone:+91.02224044006
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email:siesvs@gmail.com
Tech ID:CR46642313
Tech Name:Shankar V
Tech Organization:Sri Kanchi Mahaswami Trust
Tech Street: Sion Road, Sion West
Tech Street: 1 & 4, Kailas Bhavan, Plot 258
Tech City:Mumbai
Tech State/Province:Maharashtra
Tech Postal Code:400022
Tech Country:IN
Tech Phone:+91.02224044006
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email:siesvs@gmail.com
Name Server:NS01.DOMAINCONTROL.COM
Name Server:NS02.DOMAINCONTROL.COM
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Access to Public Interest Registry WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the Public Interest Registry registry database. The data in this record is provided by Public Interest Registry for informational purposes only, and Public Interest Registry does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to(a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Afilias except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. Public Interest Registry reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy. For more information on Whois status codes, please visit https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en.
HTTP/1.1 200 OK
Date: Sat, 01 Jun 2019 12:01:23 GMT
Server: Apache
Vary: Accept-Encoding
Transfer-Encoding: chunked
Content-Type: text/html
Кнопка для анализа сайта в один клик, для установки перетащите ссылку на "Панель закладок"