Возраст домена | n/a |
Дата окончания | Истек срок регистрации |
PR | 4 |
ИКС | 10 |
Страниц в Google | 1430 |
Страниц в Яндексе | 449 |
Dmoz | ![]() |
Яндекс Каталог | Нет |
Alexa Traffic Rank | 3456015 |
Alexa Country | Нет данных |
История изменения показателей | Авторизация |
Идет сбор информации... Обновить
Home
n/a
n/a
UTF-8
20.34 КБ
319
2 361 симв.
1 991 симв.
Данные предоставлены сервисом semrush
Сайт | Общие фразы | PR | тИЦ | Alexa Rank | Alexa Country | |
---|---|---|---|---|---|---|
![]() ![]() |
5 | 9 |
0 | 2 | ![]() | |
![]() ![]() |
4 | 9 |
0 | 5 | ![]() | |
![]() ![]() |
3 | 7 |
0 | 50589 | ![]() | |
![]() ![]() |
2 | 9 |
30 | 64940 | ![]() | |
![]() |
2 | 7 |
0 | Нет данных | ![]() |
|
![]() |
2 | 9 |
20 | 381566 | ![]() | |
![]() ![]() |
2 | 6 |
0 | 40872 | ![]() | |
![]() ![]() |
2 | 9 |
0 | 681 | ![]() | |
![]() ![]() |
2 | 5 |
0 | 334896 | ![]() | |
![]() |
2 | 1 |
0 | 8786097 | ![]() |
|
![]() ![]() |
1 | 7 |
0 | 805 | ![]() | |
![]() |
1 | 7 |
30 | 75615 | ![]() | |
![]() ![]() |
1 | 6 |
0 | 9605 | ![]() | |
![]() ![]() |
1 | 7 |
0 | 144924 | ![]() | |
![]() |
1 | 6 |
90 | 2205 | ![]() | |
![]() |
1 | 4 |
0 | 386510 | ![]() | |
![]() |
1 | 3 |
0 | 536394 | ![]() |
|
![]() ![]() |
1 | 9 |
0 | 2833 | ![]() | |
![]() ![]() |
1 | 6 |
0 | 5064 | ![]() | |
![]() ![]() |
1 | 7 |
0 | 619 | ![]() | |
Еще 30 сайтов после авторизации |
Данные предоставлены сервисом semrush
Счетчик | Посетители за 24 часа | Просмотры | Просмотров на посетителя |
---|---|---|---|
![]() | Нет доступа | Нет доступа | n/a |
Данные linkpad ( 1 Марта 2013 ) | |
Количество ссылок на сайт | 80 |
Количество доменов, которые ссылаются на сайт | 51 |
Количество найденных анкоров | 31 |
Исходящие (внешние) ссылки домена | 132 |
Количество доменов, на которые ссылается сайт | 22 |
Количество исходящих анкоров | 25 |
Внешние ссылки главной страницы ( 7 ) | |
travelsouthyorkshire.com/ | <img> |
cyclewalkscrmap.sheffieldcityregion.org.uk/ | Find out more and have your say. |
syptetest.sypte.local/WhatWeDo/Consultations | recent consultations |
Youtube.com | <img> |
Twitter.com | <img> |
Facebook.com | <img> |
Linkedin.com | <img> |
Внутренние ссылки главной страницы ( 40 ) | |
/Home | <img> |
#carouselExampleIndicators | Next |
/WhoWeAre/OurRole | About Us |
/WhoWeAre/OurPeople | Our people |
/WhoWeAre/OurFundingAndFinances | Our funding and finances |
/WhoWeAre/OurGovernance | Our governance |
/WhatWeDo/Services | <img> |
/WhatWeDo/Projects | Projects |
/WhatWeDo/Consultations | Consultations |
/WhatWeDo/Plans | Plans for the future |
/WhatWeDo/Contracts | Contracts |
/HowWeWork/SheffieldCityRegion | With Sheffield City Region |
/HowWeWork/TransportSector | With the transport sector |
/HowWeWork/LocalAuthorities | With local authorities |
/HowWeWork/Operators | With operators |
/HowWeWork/OurCustomers | With our customers |
/HowWeWork/CommunityRailGroups | With community rail groups |
/News/PressReleases | Read More... |
/News/FactsAndFigures | Transport facts & figures |
/News/WhatWeThink | What we think - Blog |
/WorkForUs/CareerWithSYPTE | A career with SYPTE |
/WorkForUs/BenefitsAndRewards | Benefits & rewards |
/WorkForUs/OurEmployees | Meet our employees |
/WorkForUs/Listings | Current vacancies |
/WorkForUs/HowToApply | How to apply |
/ContactUs/GeneralEnquiries | Contact Us |
/ContactUs/MediaEnquiries | Media enquiries |
/ContactUs/FOIRequests | FOI requests |
/ContactUs/TravelInformation | Travel information |
/ContactUs/CustomerFeedback | Customer feedback |
/News/News?id=369 | Tram Train marks one million passenger journeys |
/News/News?id=367 | New electric vehicle charging points launched at Rotherham Interchange |
/News/News?id=366 | Tram Train Scheme Wins Global Award |
/News/News?id=368 | Travel trial offer encourages commuters to ditch the car |
/home | Home |
/Sitemap | Site map |
/Copyright | Copyright |
/TermsOfUse | Terms of Use |
/PrivacyPolicy | Privacy Policy |
/Accessibility | Accessibility |
Domain name:
sypte.co.uk
Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 10-Dec-2012
Registrar:
Daisy Communications Ltd [Tag = DAISYPLC]
URL: http://www.daisygroup.com
Relevant dates:
Registered on: before Aug-1996
Expiry date: 18-Nov-2018
Last updated: 16-Oct-2017
Registration status:
Registered until expiry date.
Name servers:
auth1.dns.gxn.net
auth2.dns.gxn.net
auth3.dns.gxn.net
auth4.dns.gxn.net
WHOIS lookup made at 21:04:15 05-Oct-2018
--
User-agent: *
Disallow: /CMS/
Disallow: /uploads/
Disallow: /UploadedFiles/
Disallow: /Templates/
Disallow: /Errors/
США - Сакраменто - 134.186.61.39
California Technology Agency
California Technology Agency
HTTP/1.1 200 OK
Cache-Control: private
Content-Type: text/html; charset=utf-8
Server: Microsoft-IIS/10.0
Set-Cookie: ASP.NET_SessionId=cv5voy1uzre0xef0ueispt2u; path=/; HttpOnly; SameSite=Lax
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
Date: Thu, 19 Dec 2019 15:08:11 GMT
Content-Length: 20829
Set-Cookie: NSC_WT-Fluspo-TZQUF-TTM=ffffffffc3a0899a45525d5f4f58455e445a4a42378b;expires=Thu, 19-Dec-2019 15:28:11 GMT;path=/;secure;httponly
Кнопка для анализа сайта в один клик, для установки перетащите ссылку на "Панель закладок"