Возраст домена | 14 лет |
Дата окончания | Истек срок регистрации |
PR | 3 |
ИКС | |
Страниц в Google | 46 |
Страниц в Яндексе | 13 |
Dmoz | Нет |
Яндекс Каталог | Нет |
Alexa Traffic Rank | 15582203 |
Alexa Country | Нет данных |
История изменения показателей | Авторизация |
Two Rivers Business Association - Home
Two Rivers, Business, Association, Wisconsin
Two Rivers Business Association, TRBA
UTF-8
40.05 КБ
305
2 128 симв.
1 767 симв.
Данные предоставлены сервисом semrush
Сайт | Общие фразы | PR | тИЦ | Alexa Rank | Alexa Country | |
---|---|---|---|---|---|---|
gaysmillsorchardridge.com | 2 | 1 |
0 | 22729173 | Нет данных | |
chiltonchamber.com | 2 | 3 |
0 | Нет данных | Нет данных | |
gaysmillsapplefestfleamarket.com | 2 | n/a | 0 | 12333669 | Нет данных | |
tomsriverbasketball.com | 1 | n/a | 0 | 22108777 | Нет данных | |
townofnewton.org | 1 | n/a | 0 | 20650866 | Нет данных | |
whatarelief.biz | 1 | n/a | 0 | 14054861 | Нет данных | |
trmissions.org | 1 | n/a | 0 | Нет данных | Нет данных | |
ethnicfest.com | 1 | n/a | 0 | Нет данных | Нет данных | |
twinriversbaptist.com | 1 | n/a | 0 | Нет данных | Нет данных | |
stthomastheapostlecatholiccommunity.org | 1 | n/a | 0 | 24387842 | Нет данных | |
Еще 40 сайтов после авторизации |
Данные предоставлены сервисом semrush
Domain Name: TRBA.INFO
Domain ID: D31340201-LRMS
WHOIS Server:
Referral URL: http://registrar.1and1.info
Updated Date: 2015-01-29T22:22:14Z
Creation Date: 2010-01-29T09:39:05Z
Registry Expiry Date: 2016-01-29T09:39:05Z
Sponsoring Registrar: 1&1 Internet AG
Sponsoring Registrar IANA ID: 83
Domain Status: ok https://icann.org/epp#ok
Registrant ID: SPAG-39294392
Registrant Name: Ken Beine
Registrant Organization: Two Rivers Business Assoc.
Registrant Street: 2848 Memorial Dr
Registrant Street: PO Box 544
Registrant City: Two Rivers
Registrant State/Province: WI
Registrant Postal Code: 54241
Registrant Country: US
Registrant Phone: +1.9202429014
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: ryankauth@gmail.com
Admin ID: SPAG-39294392
Admin Name: Ken Beine
Admin Organization: Two Rivers Business Assoc.
Admin Street: 2848 Memorial Dr
Admin Street: PO Box 544
Admin City: Two Rivers
Admin State/Province: WI
Admin Postal Code: 54241
Admin Country: US
Admin Phone: +1.9202429014
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: ryankauth@gmail.com
Tech ID: C3594293-LRMS
Tech Name: Hostmaster ONEANDONE
Tech Organization: 1&1 Internet Inc.
Tech Street: 701 Lee Rd.
Tech Street: Suite 300
Tech City: Chesterbrook
Tech State/Province: PA
Tech Postal Code: 19087
Tech Country: US
Tech Phone: +1.8774612631
Tech Phone Ext:
Tech Fax: +1.6105601501
Tech Fax Ext:
Tech Email: hostmaster@1and1.com
Billing ID: C3594293-LRMS
Billing Name: Hostmaster ONEANDONE
Billing Organization: 1&1 Internet Inc.
Billing Street: 701 Lee Rd.
Billing Street: Suite 300
Billing City: Chesterbrook
Billing State/Province: PA
Billing Postal Code: 19087
Billing Country: US
Billing Phone: +1.8774612631
Billing Phone Ext:
Billing Fax: +1.6105601501
Billing Fax Ext:
Billing Email: hostmaster@1and1.com
Name Server: NS51.1AND1.COM
Name Server: NS52.1AND1.COM
>>> Last update of WHOIS database: 2015-12-03T14:41:02Z <<<
"For more information on Whois status codes, please visit https://icann.org/epp"
Access to AFILIAS WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the Afilias registry database. The data in this record is provided by Afilias Limited for informational purposes only, and Afilias does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to(a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Afilias except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. Afilias reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy.
User-agent: *
Disallow: https://www.trba.info/c/
Disallow: https://www.trba.info/protected/
Disallow: /join/pay-dues/
Disallow: /what-s-your-business/
Disallow: /thank-you/
Sitemap: https://www.trba.info/sitemap.xml
США - 191.234.210.43
Microsoft Azure
Microsoft Corporation
HTTP/1.1 200 OK
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Keep-Alive: timeout=15
Date: Thu, 23 Jan 2020 16:02:23 GMT
Server: Apache
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
X-Content-Type-Options: nosniff
X-Xss-Protection: 0;report=https://cdn.initial-website.com/app/reporting/policyviolation/submit
Content-Security-Policy-Report-Only: default-src *;script-src 'unsafe-inline' 'unsafe-eval' *;style-src 'unsafe-inline' *;connect-src * blob:;report-uri https://cdn.initial-website.com/app/reporting/policyviolation/submit
Set-Cookie: DIY_SB=9827e919c88022815d6a89817d2200da; path=/
Кнопка для анализа сайта в один клик, для установки перетащите ссылку на "Панель закладок"