Возраст домена | n/a |
Дата окончания | n/a |
ИКС | |
Страниц в Google | 2530 |
Страниц в Яндексе | 0 |
Dmoz | Нет |
Яндекс Каталог | Нет |
Alexa Traffic Rank | Нет данных |
Alexa Country | Нет данных |
История изменения показателей | Авторизация |
Идет сбор информации... Обновить
American girls, online adult dating websites
Belle Hillsboro Iowa fuck, Adult classifieds sex Milan, Girl for sex Miamisburg, Women Belluno wanting sex, Ebony women wanting couple seeking women
Adult Dating Service american girls, sexi Lawton, local girl Fort Collins.
UTF-8
30.27 КБ
1 529
11 074 симв.
9 213 симв.
Данные предоставлены сервисом semrush
Сайт | Общие фразы | PR | тИЦ | Alexa Rank | Alexa Country | |
---|---|---|---|---|---|---|
![]() |
6 | n/a | 0 | 352858 | ![]() | |
![]() |
5 | 5 |
0 | 27 | ![]() | |
![]() ![]() |
4 | 9 |
0 | 1 | ![]() | |
![]() |
2 | n/a | 0 | Нет данных | ![]() |
|
![]() ![]() |
2 | 5 |
0 | 128925 | ![]() | |
![]() ![]() |
2 | 6 |
0 | 1174 | ![]() | |
![]() |
2 | n/a | 0 | 12772110 | ![]() |
|
![]() |
2 | n/a | 0 | Нет данных | ![]() |
|
![]() |
2 | n/a | 0 | 15546662 | ![]() |
|
![]() ![]() |
2 | 4 |
0 | 728622 | ![]() | |
Еще 40 сайтов после авторизации |
Данные предоставлены сервисом semrush
Данные linkpad ( 24 Февраля 2015 ) | |
Количество ссылок на сайт | 0 |
Количество доменов, которые ссылаются на сайт | 0 |
Количество найденных анкоров | 0 |
Исходящие (внешние) ссылки домена | 0 |
Количество доменов, на которые ссылается сайт | 0 |
Количество исходящих анкоров | 0 |
Внутренние ссылки главной страницы ( 93 ) | |
maturewomenNashvilleTennessee.html | Mature women Nashville Tennessee |
freeonlinesexchatinWheeling.html | Free online sex chat in Wheeling |
freecybersex.html | Free cyber sex |
hotadultwomen.html | Hot adult women |
register.php?0wj9NNxWRp nofollow | Register Now |
login.php?rUDA2qH0fN nofollow | Login |
aboutonlinedating.html | About online dating |
ilovesex.html | I love sex |
adultchatinGaithersburgMaryland.html | Adult chat in Gaithersburg Maryland |
womenwantsforblackmen.html | Women wants for black men |
hornycougarsRichmond.html | Horny cougars Richmond |
girlsexElizabethNewJersey.html | Girl sex Elizabeth New Jersey |
indiansexSyracuseNewYork.html | Indian sex Syracuse New York |
chinasexgirl.html | China sex girl |
hothorneyinChesapeake.html | Hot horney in Chesapeake |
nudemassageKetchikanAlaska.html | Nude massage Ketchikan Alaska |
localslutsMesaArizona.html | Local sluts Mesa Arizona |
hornygrannies.html | Horny grannies |
hookersinPawtucketRhodeIsland.html | Hookers in Pawtucket Rhode Island |
nsasingles.html | Nsa singles |
fuckinggirlinMilwaukeeWisconsin.html | Fucking girl in Milwaukee Wisconsin |
cybersexchatfree.html | Cybersex chat free |
elenoraflomatonalabamaalusunitedstates.html | Slough milfs |
dorrisladonia.html | Woman sex in Matsushima |
nicholeellisburgvillage.html | Local moms looking for sex Orlando |
henriettaluebbering.html | Sex contact in Milwaukee |
gwencorsicanatx.html | Radcliff swingers sex chat rooms |
dorine-72358.html | Free sexchat Santa rosa |
silvia-60856.html | Horney personals in Trenton New Jersey |
frederica-33409.html | Webcam dating in La city |
thomasinatrippsouthdakota.html | Horny cougars in arkansas |
serena-25150.html | Free webcam in Syracuse New York |
darlenecongervilleillinoisil.html | Meet women for sex Lake Arrowhead |
stephany-12009.html | Fuck to night Butte Montana |
jasmine-96537.html | Local girl in Miami |
naomialtusok.html | Sex club in Saint Paul |
dorisdekalbmissourimo.html | Girls sex DeFuniak Springs |
shawna-97033.html | Bbw mature in Rockford Illinois |
julianaalburgvt.html | Horny pussy in Yonkers |
francinechannellakeil.html | Woman looking for sex in Amarillo |
madeleinelom.html | Sexy women of Aurora Colorado |
pamelanorthbarringtonillinoisil.html | Chat with sluts Laramie Wyoming |
wendywestmontpennsylvaniapausunitedstates.html | Black women want sex date |
penelopepeoriaheights.html | Pussy for sale Las palmas de gran canaria |
faye-70216.html | Sexe in Randallstown |
dorthyindiantrail.html | Sex Lordsburg tonitr |
jean-20063.html | Sexy older Sacramento |
robertarussellontario.html | Sex datin Wallingford |
norah-27695.html | Black girls xxx Tacoma |
marshacosttexas.html | Local moms want discrete oral sex |
linettehavelocknc.html | Pocatello women free sex web |
pamellaunivofarkatfayettevillearkansasar.html | Muscular dating Old Bar |
rosamondbrethartecdp.html | Nude women Talkeetna |
shonasmokecreeknevadanv.html | Free married pussy Prescot |
# | Report Abuse |
login.php?Tabeatiri nofollow | Tabeatiri |
login.php?schemsobepa44 nofollow | schemsobepa44 |
login.php?Tempdanneti20 nofollow | Tempdanneti20 |
login.php?Delalilo nofollow | Delalilo |
login.php?Layreppober nofollow | Layreppober |
login.php?Izvernisan39 nofollow | Izvernisan39 |
login.php?boaviralpe nofollow | boaviralpe |
login.php?Paytioplasir1986 nofollow | Paytioplasir1986 |
login.php?profanscalria1980 nofollow | profanscalria1980 |
login.php?Versetasley26 nofollow | Versetasley26 |
login.php?Fletelemen nofollow | Fletelemen |
login.php?Hartproperlia nofollow | Hartproperlia |
login.php?grapherilic nofollow | grapherilic |
login.php?Nmakfitosreu nofollow | Nmakfitosreu |
login.php?tioprefakchi38 nofollow | tioprefakchi38 |
login.php?liamugmaba1983 nofollow | liamugmaba1983 |
login.php?Surlepatketp1984 nofollow | Surlepatketp1984 |
login.php?Durfrpernesso1981 nofollow | Durfrpernesso1981 |
login.php?xyfuldigu1978 nofollow | xyfuldigu1978 |
login.php?Roughkmoundorlink1985 nofollow | Roughkmoundorlink1985 |
login.php?Lurasoti1984 nofollow | Lurasoti1984 |
login.php?marknicxalea1984 nofollow | marknicxalea1984 |
login.php?ningprivphonorth nofollow | ningprivphonorth |
login.php?newnedepa nofollow | newnedepa |
login.php?Sodepalcamf1972 nofollow | Sodepalcamf1972 |
verity-34477.html | local milfs Nashua |
login.php?purkosechi1986 nofollow | Contact Member |
dora-43987.html | girls want to fuck in Sri Lanka |
login.php?laimatchane1978 nofollow | Contact Member |
ruby-52700.html | live sex cam Ulladulla |
login.php?rselketnaver1988 nofollow | Contact Member |
joyransomillinoisil.html | arabic fucking tampa fl |
login.php?reliterta1972 nofollow | Contact Member |
myrtlecombinedlockswisconsinwi.html | About company |
paulina-15663.html | For partners |
sexclubinWestJordanUtah.html | Advertisement |
jacklynpomaria.html | Vacancies |
index.html | American girls |
Domain: womenseekinglove.eu
Registrant:
NOT DISCLOSED!
Visit www.eurid.eu for webbased whois.
Technical:
Name: IV Hostmaster
Organisation: UAB "Interneto vizija"
Language: lt
Phone: +370.52324444
Fax: +370.52077944
Email: hostmaster@iv.lt
Registrar:
Name: UAB "Interneto vizija"
Website: www.iv.lt
Name servers:
ns4.serveriai.lt
ns3.serveriai.lt
ns2.serveriai.lt
ns1.serveriai.lt
Please visit www.eurid.eu for more info.
User-agent: *
Disallow: /vfhncs/
Disallow: /rbbeqefc/
User-agent: archive.org_bot
Disallow: /
User-agent: K7MLWCBot
Disallow: /
User-agent: MauiBot
Disallow: /
User-agent: Seoterritory
Disallow: /
User-agent: DomainCrawler
Disallow: /
User-agent: NextGenSearchBot
Disallow: /
User-agent: MJ12bot
Disallow: /
User-agent: AdnormCrawler
Disallow: /
User-agent: AhrefsBot
Disallow: /
User-agent: Census
Disallow: /
User-agent: Girafabot
Disallow: /
User-agent: YisouSpider
Disallow: /
User-agent: electricmonk
Disallow: /
User-agent: CloudEndure
Disallow: /
User-agent: Pinterestbot
Disallow: /
User-agent: NetShelter
Disallow: /
США - 174.132.95.10
Softlayer
ThePlanet.com Internet Services
HTTP/1.1 200 OK
Date: Sun, 23 Jun 2019 23:23:37 GMT
Server: Apache/2
Last-Modified: Thu, 21 Apr 2016 09:30:58 GMT
ETag: "7910-530fb5e259880"
Accept-Ranges: bytes
Content-Length: 30992
Vary: Accept-Encoding,User-Agent
Content-Type: text/html
Кнопка для анализа сайта в один клик, для установки перетащите ссылку на "Панель закладок"