Возраст домена | n/a |
Дата окончания | n/a |
PR | 3 |
ИКС | 20 |
Страниц в Google | 14000 |
Страниц в Яндексе | 180 |
Dmoz | Нет |
Яндекс Каталог | Нет |
Alexa Traffic Rank | 2393 |
Alexa Country | ![]() |
История изменения показателей | Авторизация |
Идет сбор информации... Обновить
Home - Sun Gazing
n/a
n/a
UTF-8
61.02 КБ
675
4 461 симв.
3 659 симв.
Данные предоставлены сервисом semrush
Сайт | Общие фразы | PR | тИЦ | Alexa Rank | Alexa Country | |
---|---|---|---|---|---|---|
![]() ![]() |
13 | 9 |
0 | 2 | ![]() | |
![]() ![]() |
13 | 9 |
0 | 3 | ![]() | |
![]() ![]() |
9 | 9 |
0 | 5 | ![]() | |
![]() |
7 | 3 |
0 | 3911804 | ![]() |
|
![]() |
7 | 3 |
0 | 95928 | ![]() | |
![]() ![]() |
6 | 10 |
0 | 11 | ![]() | |
![]() |
6 | 4 |
20 | 3013312 | ![]() |
|
![]() |
6 | 3 |
10 | 126918 | ![]() | |
![]() ![]() |
5 | 4 |
20 | 61358 | ![]() | |
![]() ![]() |
5 | 3 |
0 | 174360 | ![]() | |
Еще 40 сайтов после авторизации |
Данные предоставлены сервисом semrush
Счетчик | Посетители за 24 часа | Просмотры | Просмотров на посетителя |
---|---|---|---|
![]() | Нет доступа | Нет доступа | n/a |
Данные linkpad ( 18 Августа 2013 ) | |
Количество ссылок на сайт | 1272 |
Количество доменов, которые ссылаются на сайт | 75 |
Количество найденных анкоров | 35 |
Исходящие (внешние) ссылки домена | 807 |
Количество доменов, на которые ссылается сайт | 246 |
Количество исходящих анкоров | 247 |
Внешние ссылки главной страницы ( 3 ) | |
sun-gazing.myshopify.com/ | <img> |
facebook.com/sungazing1 | |
twitter.com/SunGazing | |
Внутренние ссылки главной страницы ( 45 ) | |
sun-gazing.com/ | Home |
sun-gazing.com/nature/ | Nature |
sun-gazing.com/health/ | Health |
sun-gazing.com/humanity/ | Humanity |
sun-gazing.com/inspiration/ | Inspiration |
sun-gazing.com/quizzes/ | Quizzes |
sun-gazing.com/browse/ | Browse |
sun-gazing.com/about/ | About |
# | Accept |
sun-gazing.com/awesome-uses-borax-eve0ry11one-kn1o10w/ | Awesome Uses For Borax Everyone Should Know! |
sun-gazing.com/this-huge-grizzly-bear-slowly-climbs-up-the-p... | This Big Grizzly Bear Slowly Climbs Up The Pool Ladder. Now Watch His Hysterical Belly Flop. |
sun-gazing.com/lifehackwindshieldstepssimplewinterpolarvorte... | The Simplest Way To Get Ice Off Your Windshield and Stairs In Seconds During 2020’s Winter Polar Vortex |
sun-gazing.com/6712310vi1eg1arha1c0k1ev1ery1ones10101h11o1ul... | 10 Awesome Vinegar Life Hacks Everyone Should Know |
sun-gazing.com/doglovesdancingtofavoritesongincar/ | This Dog Loves Dancing To Her Favorite Song In The Car. |
sun-gazing.com/gre0atdan0epo3242525250olfitf0unny/ | Human Tells Giant Great Dane He Can’t Go Swimming. He Responds With The Most Hysterical Hissy Fit. |
sun-gazing.com/dogf1ox1wind1o0wf0u10n011nyta1nt/ | Dog Looks Out The Window And Sees a Fox Playing With His Toy. He Proceeds To Throw a Funny Tantrum. |
sun-gazing.com/each-time-this-spoiled-lil-rabbits-dad-stops-... | Each Time This Spoiled Lil Rabbit’s Dad Stops Petting Him The Bunny Throws The Funniest Tantrum! |
sun-gazing.com/amazing-alternative-uses-vic0ks-vapo1r0ub-ev0... | Vicks VapoRub Life Hacks |
sun-gazing.com/quiz-can-pass-tricky-syne0sthesia-test/ | Quiz: Can You Pass This Tricky Synesthesia Test? |
sun-gazing.com/quiz-crystal-repre9sents-soul/ | Quiz: Which Crystal Represents Your Soul? |
sun-gazing.com/quiz-personality-typ0e-sou0lmate/ | Which Personality Type Is Your Soulmate? |
sun-gazing.com/quiz-personality-a0ctu0ally-match-date-bi0rth... | Does Your Personality Actually Match The Date Of Your Birth? |
sun-gazing.com/can-figure-whats-wrong-ima0ge-less-5-seco0nds... | Can You Figure Out What’s Wrong With This Image In Less Than 5 Seconds? |
sun-gazing.com/quiz-quick-can-spot-pe0te-hidd0n-panda/ | Quiz: How Quick Can You Spot Pete The Hidden Panda? |
shop.sun-gazing.com/ | <img> |
sun-gazing.com/can-find-6-hidden-words-p01i1ct1u1re/ | Can You Find All 6 Hidden Words In The Picture Below? |
sun-gazing.com/quiz-good-friend-friend0ship-sc1o1re/ | How Good A Friend Are You? What Is Your Friendship Score? |
sun-gazing.com/qu0iz-time-period-be0long-f1in1d/ | What Time Period Do YOU Belong In? Find Out.. |
sun-gazing.com/wild-baby-wolverines-caught-film-first-ti011m... | He Spent 5 Years Of His Life Trying To Film THIS. Watch What He Caught Coming Out Of The Hole! |
sun-gazing.com/make-fi1re-usi01ng-le01mon-n01a1il1s/ | THIS Guy Hammers Nails Into This Lemon. The Awesome Reason Could Save Your Life! |
sun-gazing.com/crazy-neighbor-confronts-boy-tries-destroy-le... | Angry Neighbor Confronts Boy and Tries To Destroy His Lemonade Stand Then The Cops Show Up. |
sun-gazing.com/woman-dips-coffee-filters-bowl-wat0er-sh0es-d... | THIS Woman Dips Coffee Filters Into A Bowl Of Water. But The Reason Is Unexpectedly GENIUS! |
sun-gazing.com/forget-man-caves-new-trend-women-wo101rld-bu0... | She Built a Modest ‘She-Shed’ In Her Yard. But Then She Opens Up The Door and Reveals THIS Inside! |
sun-gazing.com/brave-guys-make-rescue-helpless-be1ar-buck10e... | THIS Creature Had A Bucket On His Head For a Month! Now Watch These Guys Attempt The UNTHINKABLE! |
sun-gazing.com/mommy-asks-2-year-old-son-drew-pink-lipstick-... | Mom Confronts Her Son About The Lipstick On The Mirror! THIS Unexpected Response Left Her Baffled! |
sun-gazing.com/page/2/ | « Older Entries |
sun-gazing.com/notice-bottle-stuck-tire-dont-touch-try-remov... | If You Notice a Bottle Stuck In Your Tire Don’t Touch Or Try To Remove It! Just Call The Police Immediately! |
sun-gazing.com/brought-camera-secluded-area-greenland-captur... | They Brought a Camera To A Secluded Area In Greenland. What They Recorded Is Simply Horrifying! |
sun-gazing.com/tearing-redoing-kitchen-ceiling-found-strange... | He Was Tearing Down and Redoing His Kitchen Ceiling. Then He Found THIS Strange Hidden Purse! |
sun-gazing.com/young-8-years-old-kid-gets-school-head-frozen... | Young 8 Years Old Kid Gets To School and His Head Is Frozen Solid. Teacher Takes a Closer Look and His Heart Is Broken! |
sun-gazing.com/privacy-policy/ | Privacy Policy |
sun-gazing.com/user-agreement/ | User Agreement |
sun-gazing.com/copyright/ | Copyright |
sun-gazing.com/contact-us/ | Contact Us |
sun-gazing.com/comments/feed/ | RSS |
[Querying whois.verisign-grs.com]
[Redirected to whois.godaddy.com]
[Querying whois.godaddy.com]
[whois.godaddy.com]
Domain Name: SUN-GAZING.COM
Registrar URL: http://www.godaddy.com
Registrant Name: Registration Private
Registrant Organization: Domains By Proxy, LLC
Name Server: NS1.SUN-GAZING.COM
Name Server: NS2.SUN-GAZING.COM
For complete domain details go to:
http://who.godaddy.com/whoischeck.aspx?domain=SUN-GAZING.COM
The data contained in GoDaddy.com, LLC's WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This
information is provided for the sole purpose of assisting you
in obtaining information about domain name registration records.
Any use of this data for any other purpose is expressly forbidden without the prior written
permission of GoDaddy.com, LLC. By submitting an inquiry,
you agree to these terms of usage and limitations of warranty. In particular,
you agree not to use this data to allow, enable, or otherwise make possible,
dissemination or collection of this data, in part or in its entirety, for any
purpose, such as the transmission of unsolicited advertising and
and solicitations of any kind, including spam. You further agree
not to use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial purposes.
Please note: the registrant of the domain name is specified
in the "registrant" section. In most cases, GoDaddy.com, LLC
is not the registrant of domain names listed in this database.
User-agent: *
Crawl-delay: 1
Disallow: /wp-content/plugins/
Disallow: /wp-admin/
США - Джэксонвилл - 108.163.234.43
SingleHop
SingleHop
HTTP/1.1 200 OK
Content-Type: text/html; charset=UTF-8
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Link: ; rel="https://api.w.org/"
Link: ; rel=shortlink
Server: Apache/2.4.10 (Amazon) PHP/5.4.38
X-Pingback: https://www.sun-gazing.com/xmlrpc.php
X-Powered-By: PHP/5.4.38
Via: 1.1 varnish
X-Cacheable: YES
Content-Length: 62485
Accept-Ranges: bytes
Date: Fri, 24 Jan 2020 08:23:18 GMT
Via: 1.1 varnish
Age: 86275
Connection: keep-alive
X-Served-By: cache-iad2148-IAD, cache-bwi5028-BWI
X-Cache: HIT, HIT
X-Cache-Hits: 1, 1
X-Timer: S1579854199.690234,VS0,VE1
Vary: Accept-Encoding
Кнопка для анализа сайта в один клик, для установки перетащите ссылку на "Панель закладок"