Возраст домена | 20 лет |
Дата окончания | Через 2 года |
PR | 3 |
ИКС | |
Страниц в Google | 9 |
Страниц в Яндексе | 8 |
Dmoz | Нет |
Яндекс Каталог | Нет |
Alexa Traffic Rank | 3911804 |
Alexa Country | Нет данных |
История изменения показателей | Авторизация |
Идет сбор информации... Обновить
Home - Sun Gazing
n/a
n/a
UTF-8
61.39 КБ
672
4 510 симв.
3 709 симв.
Данные предоставлены сервисом semrush
Сайт | Общие фразы | PR | тИЦ | Alexa Rank | Alexa Country | |
---|---|---|---|---|---|---|
youtube.com | 37 | 9 |
0 | 2 | 2 | |
wikipedia.org | 18 | 9 |
0 | 5 | 6 | |
sungazing-international.org | 13 | 1 |
0 | Нет данных | Нет данных | |
solarhealing.com | 12 | 4 |
20 | 3013312 | Нет данных | |
in5d.com | 12 | 3 |
10 | 126918 | 55088 | |
yahoo.com | 10 | 9 |
0 | 9 | 7 | |
vpinf.com | 8 | n/a | 0 | 3316289 | Нет данных | |
sungazingdangers.com | 8 | n/a | 0 | Нет данных | Нет данных | |
sun-gazing.com | 8 | 3 |
30 | 2393 | 589 | |
12160.info | 7 | 3 |
0 | 95928 | 47767 | |
Еще 40 сайтов после авторизации |
Данные предоставлены сервисом semrush
Счетчик | Посетители за 24 часа | Просмотры | Просмотров на посетителя |
---|---|---|---|
Google Analytics | Нет доступа | Нет доступа | n/a |
Ссылок в Alexa | 47 |
Данные linkpad ( 4 Марта 2013 ) | |
Количество ссылок на сайт | 36 |
Количество доменов, которые ссылаются на сайт | 26 |
Количество найденных анкоров | 13 |
Исходящие (внешние) ссылки домена | 22 |
Количество доменов, на которые ссылается сайт | 3 |
Количество исходящих анкоров | 4 |
Внешние ссылки главной страницы ( 45 ) | |
sun-gazing.com/ | Home |
sun-gazing.com/nature/ | Nature |
sun-gazing.com/health/ | Health |
sun-gazing.com/humanity/ | Humanity |
sun-gazing.com/inspiration/ | Inspiration |
sun-gazing.com/quizzes/ | Quizzes |
sun-gazing.com/browse/ | Browse |
sun-gazing.com/about/ | About |
sun-gazing.myshopify.com/ | <img> |
sun-gazing.com/this-huge-grizzly-bear-slowly-climbs-up-the-p... | This Big Grizzly Bear Slowly Climbs Up The Pool Ladder. Now Watch His Hysterical Belly Flop. |
sun-gazing.com/lifehackwindshieldstepssimplewinterpolarvorte... | The Simplest Way To Get Ice Off Your Windshield and Stairs In Seconds During 2019’s Winter Polar Vortex |
sun-gazing.com/6712310vi1eg1arha1c0k1ev1ery1ones10101h11o1ul... | 10 Awesome Vinegar Life Hacks Everyone Should Know |
sun-gazing.com/doglovesdancingtofavoritesongincar/ | This Dog Loves Dancing To Her Favorite Song In The Car. |
sun-gazing.com/gre0atdan0epo3242525250olfitf0unny/ | Human Tells Giant Great Dane He Can’t Go Swimming. He Responds With The Most Hysterical Hissy Fit. |
sun-gazing.com/dogf1ox1wind1o0wf0u10n011nyta1nt/ | Dog Looks Out The Window And Sees a Fox Playing With His Toy. He Proceeds To Throw a Funny Tantrum. |
sun-gazing.com/each-time-this-spoiled-lil-rabbits-dad-stops-... | Each Time This Spoiled Lil Rabbit’s Dad Stops Petting Him The Bunny Throws The Funniest Tantrum! |
sun-gazing.com/amazing-alternative-uses-vic0ks-vapo1r0ub-ev0... | Vicks VapoRub Life Hacks |
sun-gazing.com/25-cleaning-tricks-everyone-know-im-glad-le01... | 25 Cleaning Tricks Everyone Should Know. |
sun-gazing.com/quiz-can-pass-tricky-syne0sthesia-test/ | Quiz: Can You Pass This Tricky Synesthesia Test? |
sun-gazing.com/quiz-crystal-repre9sents-soul/ | Quiz: Which Crystal Represents Your Soul? |
sun-gazing.com/quiz-personality-typ0e-sou0lmate/ | Which Personality Type Is Your Soulmate? |
sun-gazing.com/quiz-personality-a0ctu0ally-match-date-bi0rth... | Does Your Personality Actually Match The Date Of Your Birth? |
sun-gazing.com/can-figure-whats-wrong-ima0ge-less-5-seco0nds... | Can You Figure Out What’s Wrong With This Image In Less Than 5 Seconds? |
sun-gazing.com/quiz-quick-can-spot-pe0te-hidd0n-panda/ | Quiz: How Quick Can You Spot Pete The Hidden Panda? |
shop.sun-gazing.com/ | <img> |
sun-gazing.com/7veryclearsignsanarcissististrying-to-ma00nip... | 7 Very Clear Signs a Narcissist Is Trying To Manipulate You. |
sun-gazing.com/find-col1or-imag1ination-color-get/ | Find Out The Color Of Your Imagination Below. What Color Did You Get? |
sun-gazing.com/dad-tells-dog-make-meanest-face-dog-ma1kes-fu... | Dad Tells His Dog To Make His Meanest Face. Dog Then Makes The Funniest Face Ever. |
sun-gazing.com/simplest-way-gr0ow-to0mato-see1d0lings-h0o11m... | He Takes 4 Slices Of Tomatoes and Places It In Compost. 10 Days Later He Reveals The UNTHINKABLE! |
sun-gazing.com/happens-body-drink-water-m-e0mpty-sto1m0ach-1... | This Is What Happens To Your Body When You Drink Water In The A.M. On An Empty Stomach For 1 Month! |
sun-gazing.com/2-naughty-grannies-spot-a-handsome-young-man-... | 2 Naughty Grannies Spot A Handsome Young Man. What They Do Next Is Unexpectedly Hilarious. |
sun-gazing.com/lady-buys-2-old-tarnished-che0ese-gr0ater-tra... | She Buys A $2 Old Tarnished Cheese Grater But When She Reveals Her Transformation It’s AWESOME. |
sun-gazing.com/many-great-loves-will-lifetime-acco0rd1ing-zo... | How Many Great Loves Will You Have In Your Lifetime According To Your Zodiac Sign? |
sun-gazing.com/page/2/ | « Older Entries |
sun-gazing.com/tiny-pup-terrifie0d-stai0rs-de01cides-g01et-h... | This Pup Is Terrified Of The Stairs. How He Decides To Get Down Is Unexpectedly Hilarious. |
sun-gazing.com/grilling-tip-man-starts-rubbing-potato-bbq-g1... | THIS Man Starts Rubbing a Potato All Over His BBQ Grill. The Reason Is Unexpectedly GENIUS! |
sun-gazing.com/guy-just-moved-new-house-completely-stunned-s... | Guy Just Moved Into a New House But He Is Completely Stunned By This Strange Surprise Underneath His Basement! |
sun-gazing.com/texas-mother-thought-giving-birth-twins-doc-l... | Texas Mother Thought She Was Giving Birth To Twins. But Then The Doc Looks Closer and Immediately Yells ‘Help!’ |
sun-gazing.com/privacy-policy/ | Privacy Policy |
sun-gazing.com/user-agreement/ | User Agreement |
sun-gazing.com/copyright/ | Copyright |
sun-gazing.com/contact-us/ | Contact Us |
facebook.com/sungazing1 | |
twitter.com/SunGazing | |
sun-gazing.com/comments/feed/ | RSS |
Внутренние ссылки главной страницы ( 1 ) | |
# | Accept |
Domain Name: SUNGAZING.COM
Registry Domain ID: 98790431_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2017-05-01T04:46:20Z
Creation Date: 2003-06-05T16:56:28Z
Registry Expiry Date: 2026-06-05T16:56:28Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS21.DOMAINCONTROL.COM
Name Server: NS22.DOMAINCONTROL.COM
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2018-10-05T06:37:05Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar. Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.
TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.
The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.
США - 208.82.16.68
Ning
Ning
HTTP/1.1 200 OK
Content-Type: text/html; charset=UTF-8
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Link: ; rel="https://api.w.org/"
Link: ; rel=shortlink
Server: Apache/2.4.10 (Amazon) PHP/5.4.38
X-Pingback: https://www.sun-gazing.com/xmlrpc.php
X-Powered-By: PHP/5.4.38
Via: 1.1 varnish
X-Cacheable: YES
Content-Length: 62867
Accept-Ranges: bytes
Date: Fri, 27 Dec 2019 02:14:18 GMT
Via: 1.1 varnish
Age: 50638
Connection: keep-alive
X-Served-By: cache-iad2128-IAD, cache-bwi5047-BWI
X-Cache: HIT, HIT
X-Cache-Hits: 1, 1
X-Timer: S1577412858.110083,VS0,VE1
Vary: Accept-Encoding
Кнопка для анализа сайта в один клик, для установки перетащите ссылку на "Панель закладок"